KEGG   Escherichia coli APEC O1 (APEC): APECO1_4094Help
Entry
APECO1_4094       CDS       T00425                                 

Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00620  Pyruvate metabolism
ecv01100  Metabolic pathways
ecv01120  Microbial metabolism in diverse environments
ecv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APECO1_4094
Enzymes [BR:ecv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     APECO1_4094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ABJ01858
UniProt: A0A0H2Z181
LinkDB All DBs
Position
complement(2698279..2700558)
Genome map
AA seq 759 aa AA seqDB search
MDDQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAAPCLEIEKDPLKAYKY
TARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGIDVFDIEVDELDPDKFI
EVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFHDDQHGTAIISTAAILNGLRV
VEKNISDVRMVVSGAGAAAIACMNLLVALGLQKHNIVVCDSKGVIYQGREPNMAETKAAY
AVVDDGKRTLDDVIEGADIFLGCSGPKVLTQEMVKKMARAPMILALANPEPEILPPLAKE
VRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAINEEMKLAAVRAIAELAHAEQS
EVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKAAMESGVATRPIADFDVYIDKL
TEFVYKTNLFMKPIFSQARKAPKRVVLPEGEEARVLHATQELVTLGLAKPILIGRPNVIE
MRIQKLGLQIKSGVDFEIVNNESDPRFKEYWTEYFQIMKRRGVTQEQAQRALISNPTVIG
AIMVQRGEADAMICGTVGDYHEHFSVVKNVFGYRDGVHTAGAMNALLLPSGNTFIADTYV
NDEPDAEELAEITLMAAETVRRFGIEPRVALLSHSNFGSSDCPSSSKMRQALELVRERAP
ELMIDGEMHGDAALVEAIRNDRMPDSPLKGSANILVMPNMEAARISYNLLRVSSSEGVTV
GPVLMGVAKPVHVLTPIASVRRIVNMVALAVVEAQTQPL
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggatgaccagttaaaacaaagtgcacttgatttccatgaatttccagttccagggaaa
atccaggtttctccaaccaagcctctggcaacgcagcgcgatctggcgctggcctactca
ccaggcgttgccgcaccttgtcttgaaatcgaaaaagacccgttaaaagcctacaaatat
accgcgcgcggtaacctggtagcggtgatctctaacggtacggcggtgctggggttaggc
aacattggcgcgctggcaggcaaaccggtgatggaaggcaagggcgttctgtttaagaaa
ttcgccgggattgatgtatttgacattgaagttgatgaactcgacccggacaaatttatt
gaagtcgtcgctgcgctcgaaccgaccttcggcggcatcaacctcgaagacattaaagcg
ccagaatgtttctatattgaacagaaactgcgcgagcggatgaatattccggtattccac
gacgatcagcacggcacggcaattatcagcactgccgccatcctcaacggcttgcgcgtg
gtggagaaaaacatctccgacgtgcggatggtggtttctggcgcgggtgccgcagcaatc
gcctgtatgaacctgctggtagcgctgggtctgcaaaaacataacatcgtggtttgcgat
tcaaaaggcgttatctatcagggccgtgagccaaacatggcggaaaccaaagctgcatac
gcggtggtggatgacggtaaacgtaccctcgatgatgtgattgaaggcgcggatattttc
ctcggctgttccggcccgaaagtgctgacccaggaaatggtgaagaaaatggcccgtgcg
ccaatgatcctggcgctggcgaacccggaaccggaaattctgccgccgctggcgaaagaa
gtgcgtccggatgccatcatctgtaccggccgttccgactacccgaaccaggtgaacaac
gtcctttgcttcccgtttatcttccgtggcgcgctggacgttggcgcaaccgccatcaac
gaagagatgaaactggcggcggtacgcgcgattgcagaactggcccatgcggaacagagt
gaagtggtggcttcagcgtatggcgatcaggatctgagctttggtccggaatacatcatt
ccaaaaccgtttgatccgcgcttgatcgttaagatcgctcctgcggtggcgaaagcggcg
atggagtcgggcgtggcgacgcgtccgattgctgatttcgacgtctacatcgacaagctg
acagagttcgtttacaaaactaacctgtttatgaagccgattttctcccaggctcgcaaa
gcgccgaagcgcgtagttctgccggaaggggaagaggcgcgcgttctgcatgccactcag
gaactggtaacgctgggactggcgaaaccgatccttattggtcgtccgaacgtgatcgaa
atgcgcattcagaaactgggcttgcagatcaagtcgggcgttgattttgagatcgtcaat
aacgaatccgatccgcgttttaaagagtactggaccgaatacttccagatcatgaagcgt
cgcggtgtcactcaggagcaggcgcagcgtgcgctgatcagtaacccgacagtgatcggc
gcgatcatggttcagcgtggcgaagccgatgcaatgatttgcggtacggtgggcgattat
catgaacactttagcgtggtgaaaaatgtctttggttatcgcgatggcgttcacaccgca
ggtgcaatgaacgcgctgctgttgccgagtggtaacacctttattgccgatacctacgtc
aatgatgagcctgatgcagaagagctggcggagatcaccttgatggcggcagaaactgtt
cgtcgttttggtattgaaccgcgtgtggctctgttgtcgcactccaactttggttcttct
gactgcccgtcgtcgagcaaaatgcgtcaggcgctggaactggtcagggaacgtgcgcca
gaactgatgattgatggtgaaatgcacggcgatgcagcgctggtggaagcgattcgcaac
gaccgtatgccggacagccctttgaaaggttccgctaatattctggtgatgccgaacatg
gaagctgcccgcattagttacaacttactgcgcgtttccagctcggaaggtgtgactgtc
ggtccggtgctgatgggcgtggcgaaaccggttcacgtgttaacgccgatcgcatcggta
cgtcgtatcgtcaacatggtggcgctggccgtggttgaagcgcaaacccaaccgctgtaa

DBGET integrated database retrieval system