KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_0410Help
Entry
EcE24377A_0410    CDS       T00590                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00730  Thiamine metabolism
ecw00790  Folate biosynthesis
ecw01100  Metabolic pathways
ecw02020  Two-component system
Module
ecw_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    EcE24377A_0410 (phoA)
   00790 Folate biosynthesis
    EcE24377A_0410 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EcE24377A_0410 (phoA)
Enzymes [BR:ecw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     EcE24377A_0410 (phoA)
Exosome [BR:ecw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EcE24377A_0410 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecw00537]
 Enzymes
  EcE24377A_0410 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: ABV17881
UniProt: A7ZID2
LinkDB All DBs
Structure
PDB: 

Position
434727..436142
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLSLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttatcgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgtttaacgggtgatcagactgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggattcggaaatt
acagccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaaccggactac
gtcaccgattcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcacatgtgacttcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgct
cgtgccgacgttacgcttggcggtggcgcaaaaacctttgctgaaacggcaaccgccggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtcagc
gatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacctctgcttggactg
tttgctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtaccacggcaat
atcgataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagtgtaccaacc
ctggcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggatttttc
ctgcaagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgctaaaaag
gatggcaatacgctggtcatagtcaccgctgatcacgcccacgccagccagattgtcgcg
ccggataccaaagctccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagctacgggaactccgaagaggattcacaagaacataccggcagtcagttgcgt
attgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgccctggggctgaaataa

DBGET integrated database retrieval system