KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_0783Help
Entry
EcE24377A_0783    CDS       T00590                                 

Gene name
galM
Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00010  Glycolysis / Gluconeogenesis
ecw00052  Galactose metabolism
ecw01100  Metabolic pathways
ecw01110  Biosynthesis of secondary metabolites
ecw01120  Microbial metabolism in diverse environments
ecw01130  Biosynthesis of antibiotics
Module
ecw_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcE24377A_0783 (galM)
   00052 Galactose metabolism
    EcE24377A_0783 (galM)
Enzymes [BR:ecw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     EcE24377A_0783 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABV19054
UniProt: A7ZJD1
LinkDB All DBs
Position
complement(807262..808302)
Genome map
AA seq 346 aa AA seqDB search
MLNETPALAPDGQPYRLLTLRNNAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPE
CYQDQAAFLGASIGRYANRIANSRYTFDGETVTLSPSQGVNQLHGGPEGFDKRRWQIVNQ
NDRQVLFALSSDDGDQGFPGNLGATVQYRLTDDNRISITYRATVDKPCPVNMTNHVYFNL
DGEQSDVRNHKLQILADEYLPVDEGGIPHDGLKSVAGTSFDFRSAKIIASEFLADDDQRK
VKGYDHAFLLQAKGDGKKVAAHVWSADEKLQLKVYTTAPALQFYSGNFLGGTPSRGTEPY
ADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTEYQFIAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaacgaaactcccgcactggcacccgatggtcagccgtaccgactgttaactttg
cgtaacaacgcagggatggtagtcacgctgatggactggggtgcgactttactttccgcc
cgtattccgctttccgatggcagcgtccgcgaggcgctgctcggctgtgccagcccggaa
tgctatcaggatcaggctgcgtttctgggggcctctattggtcgttatgccaaccgcatc
gccaatagtcgttatacctttgacggtgaaaccgtgacgctttcgccaagtcagggcgtt
aaccagctgcacggcggcccggaagggttcgacaaacgtcgctggcagattgtgaaccag
aacgatcgtcaggtgctgtttgccctgagttcagatgatggcgatcagggcttcccgggt
aatctcggcgcgacggtgcaatatcgtctgaccgacgataaccgtatctccattacttat
cgcgccacagttgataaaccttgcccggtgaatatgactaatcacgtctatttcaatctt
gacggcgagcagtctgacgtgcgcaatcacaagttgcagattctggcggacgaatatctg
ccggttgatgaaggcggcattccgcacgacggcttgaaatctgtcgccggaacgtctttt
gatttccgcagcgccaaaatcatcgccagtgagtttcttgccgacgacgatcagcgcaaa
gtgaaaggttacgatcacgcattcttgttacaggccaaaggcgatggcaagaaagtggcg
gcgcatgtctggtcagcagatgaaaaattgcagctgaaggtctacaccaccgctccggct
ctgcaattctactccggcaacttcctcggcggcacaccgtcgcggggaaccgaaccttac
gccgactggcaaggactggctctggaaagcgagtttctgccggacagcccgaaccaccct
gaatggccgcaaccggactgcttcctgcgtcctggcgaagagtattccagcctgacggaa
tatcagtttattgctgagtaa

DBGET integrated database retrieval system