KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_2154Help
Entry
EcE24377A_2154    CDS       T00590                                 

Gene name
fliY
Definition
(GenBank) cystine-binding periplasmic protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EcE24377A_2154 (fliY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecw02000]
    EcE24377A_2154 (fliY)
   02035 Bacterial motility proteins [BR:ecw02035]
    EcE24377A_2154 (fliY)
Transporters [BR:ecw02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    EcE24377A_2154 (fliY)
Bacterial motility proteins [BR:ecw02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    EcE24377A_2154 (fliY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: ABV18712
UniProt: A7ZN45
LinkDB All DBs
Position
complement(2126404..2127204)
Genome map
AA seq 266 aa AA seqDB search
MKLAHLGRQALMGVMAVALVAGMSVKSFADEGLLNKVKERGTLLVGLEGTYPPFSFQGDD
GKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDF
STPYTISGIQALVKKGNEGTLKTAADLKGKKVGVGLGTNYEEWLRQNVQGVDVRTYDDDP
TKYQDLRVGRIDAILVDRLAALDLVKKTNDTLAVTGEAFSRQESGVALRKGNEDLLKAVN
DAIAEMQKDGTLQALSEKWFGADVTK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcacatctgggacgtcaggcattgatgggtgtgatggccgtggcgctggtt
gcgggcatgagcgttaaaagttttgcagatgaaggtctgcttaataaagtcaaagagcgc
ggtacgctactggtagggctggaaggaacttatccgccgttcagttttcagggggatgac
ggcaaattaaccggttttgaagtggaatttgcccaacagctggcaaaacatcttggcgtt
gaggcgtcactaaaaccgaccaaatgggacggtatgctggcgtcgctggactctaaacgc
attgatgtggtgattaatcaggtcaccatttctgacgagcgcaagaaaaaatacgatttc
tctaccccttacaccatttccggtattcaggcgctggtgaaaaaaggtaacgaaggcacc
cttaaaacggctgctgatctgaaaggcaaaaaagtgggtgtcggtctgggcaccaactat
gaagagtggctgcggcagaatgttcagggtgtcgatgtgcgtacctatgatgatgacccg
accaaatatcaggatctgcgcgtagggcgtatcgatgcgatcctcgttgatcgtctggcg
gcgctggatctggtgaagaaaaccaacgatacgctggcagtaaccggtgaagcattctcc
cgtcaggagtctggcgtggcgctgcgtaaaggaaatgaggacctgctgaaagcggtgaat
gatgcaattgcggaaatgcaaaaagacggcactctgcaagctctttccgaaaaatggttt
ggtgctgatgtgaccaaataa

DBGET integrated database retrieval system