KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_2942Help
Entry
EcE24377A_2942    CDS       T00590                                 

Gene name
gabT2
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00250  Alanine, aspartate and glutamate metabolism
ecw00280  Valine, leucine and isoleucine degradation
ecw00310  Lysine degradation
ecw00410  beta-Alanine metabolism
ecw00640  Propanoate metabolism
ecw00650  Butanoate metabolism
ecw01100  Metabolic pathways
ecw01120  Microbial metabolism in diverse environments
Module
ecw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EcE24377A_2942 (gabT2)
   00650 Butanoate metabolism
    EcE24377A_2942 (gabT2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EcE24377A_2942 (gabT2)
   00280 Valine, leucine and isoleucine degradation
    EcE24377A_2942 (gabT2)
   00310 Lysine degradation
    EcE24377A_2942 (gabT2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EcE24377A_2942 (gabT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecw01007]
    EcE24377A_2942 (gabT2)
Enzymes [BR:ecw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EcE24377A_2942 (gabT2)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     EcE24377A_2942 (gabT2)
    2.6.1.48  5-aminovalerate transaminase
     EcE24377A_2942 (gabT2)
Amino acid related enzymes [BR:ecw01007]
 Aminotransferase (transaminase)
  Class III
   EcE24377A_2942 (gabT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABV20288
UniProt: A7ZQ93
LinkDB All DBs
Structure
PDB: 

Position
2953258..2954538
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAGIVIEPVQGEGGFYATTPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLAIEDAQIRQGLEIISQC
FDEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaagtggttgccgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcctacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtaaaa
atcgcccgtgccgccaccaaacgtagcggtaccatcgcctttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgcctgggcacgtttatcgcgcgctttatccttgcccgctgcacggcatcagtgaa
gatgacgctatcgccagcatccatcgaatcttcaaaaatgacgccgcgccggaagatatc
gccggcatcgtgattgaaccggttcagggcgaaggcggtttctacgccactacgcctgct
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatctcaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggcggtctgggcggcacctatgcgggt
aacccgattgcctgcgtggccgcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaagttgaaagacggattgctggcaatagccgaa
aaacacccggagatcggcgacgtacgcgggctgggggcgatgatcgccattgagctgttt
gaagacggcgatcacaacaagccggacgccaaactcaccgccgagatcgtggctcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcgccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgatgaggcgaagcagtag

DBGET integrated database retrieval system