KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_3275Help
Entry
EcE24377A_3275    CDS       T00590                                 

Definition
(GenBank) PTS system sorbose-specific iic component
  KO
K17466  D-glucosaminate PTS system EIIC component
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00030  Pentose phosphate pathway
ecw01120  Microbial metabolism in diverse environments
ecw02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EcE24377A_3275
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    EcE24377A_3275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecw02000]
    EcE24377A_3275
Transporters [BR:ecw02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   D-Glucosaminate-specific II component
    EcE24377A_3275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EII-Sor
Motif
Other DBs
NCBI-ProteinID: ABV18302
UniProt: A7ZR55
LinkDB All DBs
Position
complement(3292250..3292999)
Genome map
AA seq 249 aa AA seqDB search
MDTLLFASLMGLYYWFARLRLGYTFSAMLLQPVVVAVFVGLLLGNMPAAMIIGAGMQLVY
LGVTSTPGGNVPSDPALAACIAIPIAVKANMDPNLAIALAIPFGVIGVFLDQLRRTLNAA
WVHMADKHAETANMSAIMRCAFLYPALLGLVLRFPVVFAANYFGQNVVESFLKLMPHWLT
HSFEIMGGILPALGFAITIMVIGKKSLLPWFIGGFFAVLYLKVDIMAMAIFGTCVAFLIK
GLAKNEGAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggataccttactttttgcaagcctgatggggctgtattactggtttgcccggttgcgc
cttggctataccttctccgccatgctgttacagccagtggtggtggcggtctttgtcggc
ctgctgctcggcaatatgcctgcggcgatgattatcggcgcggggatgcagttggtctat
ctgggtgtgacctcaacgccaggcggcaatgtgccgtcagacccggcgctggcggcctgt
atcgccattcctatcgccgttaaggccaatatggacccgaacctggcgattgcactggcg
attccatttggcgttatcggcgtattcctcgaccagttgcgtcgcacgctaaatgcggcc
tgggtgcatatggccgataaacacgcggaaacggccaatatgtcagccattatgcgctgc
gcctttctctacccggcgctgctggggctggtactacgtttcccagtggtgttcgccgcc
aactacttcggccagaacgtagtggaaagtttcctcaagctgatgccgcactggctgacc
cactcgtttgaaatcatgggcgggattctcccggcgctgggcttcgccatcaccattatg
gtgattggtaaaaagagcctgctgccgtggtttatcggcggattcttcgcggtgctgtac
ctcaaggtggacatcatggcgatggcgattttcggcacctgcgtggccttcctgattaaa
ggcctggcgaaaaatgaaggagcggcataa

DBGET integrated database retrieval system