KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_4230Help
Entry
EcE24377A_4230    CDS       T00590                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00010  Glycolysis / Gluconeogenesis
ecw00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ecw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcE24377A_4230
   00500 Starch and sucrose metabolism
    EcE24377A_4230
Enzymes [BR:ecw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EcE24377A_4230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038 Albumin_I_a
Motif
Other DBs
NCBI-ProteinID: ABV18371
UniProt: A7ZTS6
LinkDB All DBs
Position
complement(4219076..4220470)
Genome map
AA seq 464 aa AA seqDB search
MKAFPETFLWGGATAANQVEGAWQEDGKGISTSDLQPHGVMGKMEPRILGKENIKDVAID
FYHRYPEDIALFAEMGFTCLRISIAWARIFPQGDEVEPNEAGLAFYDRLFDEMAQAGIKP
LVTLSHYEMPYGLVKNYGGWANRAVIDHFEHYARTVFTRYQHKVALWLTFNEINISLHEP
FTGVGLAEESGEAEVYQAIHHQLVASARAVKACHSLLPEAKIGNMLLGGLVYPLTCQPQD
MLQAMEENRRWMFFGDVQARGQYPGYMQRFFRDHNITIEMTESDAEDLKHTVDFISFSYY
MTGCVSHDESINKNAQGNILNMIPNPHLKSSEWGWQIDPVGLRVLLNTLWDRYQKPLFIV
ENGLGAKDSVEADGSIQDDYRIAYLNDHLVQVNEAITDGVDIMGYTSWGPIDLVSASHSQ
MSKRYGFIYVDRDDNGEGSLTRTRKKSFGWYAEVIKTRGLSLKK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttccagaaacatttctttggggtggcgcaacagctgccaatcaggtggaa
ggtgcctggcaggaagatggcaaagggatctcgacctcagatttacagcctcatggcgta
atgggaaaaatggaaccgcgcatcctggggaaagagaatatcaaagatgtcgccatcgat
ttttatcaccgttacccggaagatatcgcgttatttgccgagatgggcttcacctgtctg
cgtatttccattgcctgggcgcgaattttccctcagggcgacgaagtcgaaccgaatgaa
gcggggttagcgttttacgatcggctgtttgatgaaatggcgcaggcggggatcaagccg
ctggtaacgttatcccattacgaaatgccatatgggctggtgaaaaactacggcggttgg
gctaatcgagcggtcatcgatcacttcgagcattacgcccgcacggtctttactcgctac
caacataaagtggcgttatggctgacgtttaatgaaatcaacatatcgttacacgagcca
ttcacgggcgtggggctggcagaagagagtggcgaggcggaagtttatcaggctatccac
catcaactggttgccagtgcgcgggcagttaaagcctgtcatagcctgctccccgaagcg
aaaatcggcaatatgcttctcggtgggctggtttaccccctcacctgccagccacaggat
atgttgcaggccatggaagagaaccggcgctggatgttctttggtgatgttcaggcgcgt
ggccagtatcccggctatatgcagcgtttcttccgcgaccacaatatcaccattgagatg
actgaaagtgacgcagaagatttaaaacatactgtagatttcatctcttttagttattac
atgactggttgtgtttcccacgacgaaagcattaataaaaatgcgcagggcaacatactg
aatatgatccccaatccgcatctgaaaagttcagagtgggggtggcaaattgatccggtt
ggattacgggttctgttaaatacgctttgggatcgttatcaaaaaccgttatttattgtc
gagaacggattaggcgcaaaagacagcgttgaagcggatggttcgatacaggacgattat
cgaattgcctatttaaacgatcacctggtacaggtaaatgaagcgattaccgatggtgtg
gatattatggggtacaccagttgggggccaattgatttagtcagtgcatctcattcacaa
atgtctaagcgctacggctttatttatgtggatcgtgatgataatggcgaaggaagcctc
acaagaacgcgtaagaaaagcttcggatggtatgcagaagtgatcaaaacgcgggggctg
tcattaaaaaaataa

DBGET integrated database retrieval system