KEGG   Escherichia coli O139 H28 E24377A (ETEC): EcE24377A_4495Help
Entry
EcE24377A_4495    CDS       T00590                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ecw  Escherichia coli O139:H28 E24377A (ETEC)
Pathway
ecw00620  Pyruvate metabolism
ecw00680  Methane metabolism
ecw01100  Metabolic pathways
ecw01120  Microbial metabolism in diverse environments
ecw01200  Carbon metabolism
Module
ecw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ecw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EcE24377A_4495 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    EcE24377A_4495 (ppc)
Enzymes [BR:ecw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EcE24377A_4495 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABV21083
UniProt: A7ZUH4
LinkDB All DBs
Structure
PDB: 

Position
complement(4484759..4487410)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILERVETIRKLSKSSRAGNDANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPELSED
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEHNQLMRRLRQ
LIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVEF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEATPELL
ALVGEEGAAEPYRYLMKNLRSRLMATQAWLEARLKGEELPKPEGLLTQNEELWEPLYACY
QSLQACGMGIIANGDLLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWQPSAETREVLDTCQVIAEAPQGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNANDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEITVSSLSLYTGAILEANLLPPPEPKESWRRIMDEL
SVISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVDKALWPLGKELRNLQEEDIKVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEKEGQEPDPRVEQALMVTIAGIAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaagtgctggga
gaaaccatcaaggatgcgttgggagaacacattcttgaacgcgtagaaactatccgtaag
ttgtcgaaatcttcacgcgctggcaatgatgctaaccgccaggagttgctcaccacctta
caaaatttgtcgaacgacgagctgctgcccgttgcgcgtgcgtttagtcagttcctgaac
ctggccaacaccgccgagcaataccacagcatttcgccgaaaggcgaagctgccagcaac
ccggaagtgatcgcccgcaccctgcgtaaactgaaaaaccagccggaactgagcgaagac
accatcaaaaaagcagtggaatcgctgtcgctggaactggtcctcacggctcaccctacc
gaaattacccgtcgtacactgatccacaaaatggtggaagtgaacgcctgcttaaaacag
ctcgataacaaagatatcgctgactacgaacacaaccagctgatgcgtcgcctgcgccag
ttaatcgcccagtcatggcataccgatgaaatccgtaagctgcgtccaagcccggtagat
gaagccaaatggggctttgccgtagtggaaaacagcctgtggcaaggcgtaccaaattac
ctgcgcgaactgaacgaacaactggaagagaacctcggctacaaactgcccgtcgaattt
gttccggtccgttttacttcgtggatgggcggcgaccgcgacggcaacccgaacgtcact
gccgatatcacccgccacgtcctgctactcagccgctggaaagccaccgatttgttcctg
aaagatattcaggtgctggtttctgaactgtcgatggttgaagcgacccctgaactgctg
gcgctggttggcgaagaaggtgccgcagaaccgtatcgctatctgatgaaaaacctgcgt
tctcgcctgatggcgacacaggcatggctggaagcgcgcctgaaaggcgaagaactgcca
aaaccagaagggctgctgacacaaaacgaagaactgtgggaaccgctctacgcttgctac
cagtcacttcaggcgtgtggcatgggtattatcgccaacggcgatctgctcgacaccctg
cgccgcgtgaaatgtttcggcgtaccgctggtccgtattgatatccgtcaggagagcacc
cgccataccgaagcactgggtgaactgacccgctacctcggtatcggcgactacgagagc
tggtcagaagctgacaaacaggcgttcctgatccgcgaactgaactccaaacgtccgctg
ctaccgcgcaactggcaaccaagcgccgaaacgcgcgaagtgctcgatacctgccaggtg
attgccgaagcgccgcaaggctccattgccgcctacgtgatctcgatggcgaaaacgccg
tccgacgtgctggctgtccacctgctgctgaaagaagcgggtatcgggtttgcgatgccg
gttgctccgctgtttgaaaccctcgatgacctgaacaacgccaacgatgtcatgacccag
ctgctgaatatcgactggtatcgcggcctgattcagggcaaacagatggtgatgattggc
tattccgactcagcaaaagatgcgggagtgatggcagcttcctgggcgcaatatcaggca
caggatgcattaatcaaaacctgcgaaaaagcgggtattgagctgacgttgttccacggt
cgcggcggttccattggtcgcggcggcgcacctgctcatgcggcgctgctgtcacaaccg
ccaggaagcctgaaaggtggcctgcgcgtgactgaacagggcgagatgatccgctttaaa
tatggtctgccagaaatcaccgtcagcagcctgtcgctgtataccggggcgattctggaa
gccaacctgctgccaccgccggagccgaaagagagctggcgtcgcattatggatgaactg
tcagtcatctcctgcgatctctaccgtggctacgtacgtgaaaacaaagattttgtgcct
tacttccgctccgctacgccggaacaagaattgggcaaactgccgttgggttcacgtccg
gcgaaacgtcgcccaaccggcggcgtcgagtcgctgcgcgccataccgtggatttttgcc
tggacgcaaaaccgcctgatgctccccgcctggctgggtgcaggtacggcgctgcaaaaa
gtggtcgaagacggcaaacagagcgagctggaggctatgtgccgcgattggccattcttc
tcgacgcgtctcggcatgctggagatggtcttcgccaaagcagacctgtggctggcggaa
tactatgatcaacgcctggtagacaaagcactgtggccgttaggtaaagagttacgcaat
ctgcaagaagaagacatcaaagtggtgctggcaattgccaacgattcccatctgatggcc
gatctgccgtggattgcagagtctattcagctacggaatatttacaccgacccgctgaac
gtattgcaagccgagttgctgcaccgctcccgccaggcagaaaaagaaggccaggaaccg
gatcctcgcgtcgaacaagcgttaatggtcactattgccgggattgcggcaggtatgcgt
aataccggctaa

DBGET integrated database retrieval system