KEGG   Escherichia coli O9 HS (commensal): EcHS_A0182Help
Entry
EcHS_A0182        CDS       T00591                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00061  Fatty acid biosynthesis
ecx00780  Biotin metabolism
ecx01100  Metabolic pathways
ecx01212  Fatty acid metabolism
Module
ecx_M00083  Fatty acid biosynthesis, elongation
ecx_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EcHS_A0182 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EcHS_A0182 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecx01004]
    EcHS_A0182 (fabZ)
Enzymes [BR:ecx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     EcHS_A0182 (fabZ)
Lipid biosynthesis proteins [BR:ecx01004]
 Fatty acid synthase
  Component type
   EcHS_A0182 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: ABV04580
UniProt: A7ZWC6
LinkDB All DBs
Structure
PDB: 

Position
200258..200713
Genome map
AA seq 151 aa AA seqDB search
MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNESFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactaacactcatactctgcagattgaagagattttagaacttctgccgcaccgt
ttccctttcttactggtggatcgcgtgctggattttgaagaaggtcgttttctgcgcgca
gtaaaaaatgtctctgtcaatgagtcattcttccagggccatttccctggaaaaccgatt
ttcccgggtgtgctgattctggaagcaatggcacaggcaacaggtattctggcgtttaaa
agcgtaggaaaactggaaccgggtgagctgtactatttcgctggtattgacgaagcgcgc
ttcaagcgcccggtcgtgcctggcgatcaaatgatcatggaagtcactttcgaaaaaacg
cgccgcggcctgacccgttttaaaggggttgctctggtcgacggtaaagtagtttgcgaa
gcaacgatgatgtgtgctcgtagccgggaggcctga

DBGET integrated database retrieval system