KEGG   Escherichia coli O9 HS (commensal): EcHS_A1417Help
Entry
EcHS_A1417        CDS       T00591                                 

Gene name
gabT1
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00250  Alanine, aspartate and glutamate metabolism
ecx00410  beta-Alanine metabolism
ecx00640  Propanoate metabolism
ecx00650  Butanoate metabolism
ecx01100  Metabolic pathways
ecx01120  Microbial metabolism in diverse environments
Module
ecx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EcHS_A1417 (gabT1)
   00650 Butanoate metabolism
    EcHS_A1417 (gabT1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EcHS_A1417 (gabT1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EcHS_A1417 (gabT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecx01007]
    EcHS_A1417 (gabT1)
Enzymes [BR:ecx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EcHS_A1417 (gabT1)
Amino acid related enzymes [BR:ecx01007]
 Aminotransferase (transaminase)
  Class III
   EcHS_A1417 (gabT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABV05748
LinkDB All DBs
Position
1413003..1414268
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPD
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINALAPVSGQAKTAFFTTGAEAVENAVKM
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQ
DSLDAIERLFKSDIEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEV
QSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDKESLCKRANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAAEFND
PQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALS
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgccaccccgcgcggggttggcgtg
atgtgtaacttcttcgcccagtcggctgaaaacgctacgctgaaggatgttgagggcaac
gagtacatcgatttcgccgcaggcattgcggtgctgaataccgggcatcgccaccctgat
ctggtcgcggcggtggagcagcaactgcaacagtttacccacaccgcgtatcagattgtg
ccgtatgaaagctacgtcaccctggcggagaaaatcaacgcccttgccccggtgagcggg
caggccaaaaccgcgttcttcactaccggcgcggaagcggtggaaaacgcggtgaaaatg
gctcgcgcccataccggacgacctggcgtgattgcgtttagcggtggcttccacggtcgt
acatatatgaccatggcgctgaccggaaaagttgcgccgtacaaaatcggcttcggcccg
ttccctggttcggtgtatcacgtaccttatccgtcagatttacacggcatttcaacacag
gactccctcgacgccatcgaacgcttgtttaaatcagacatcgaagcgaagcaggtcgcg
gccattattttcgaaccggtgcagggcgagggcggtttcaacgttgcgccaaaagagctg
gttgccgccattcgccgcctgtgcgacgagcacggtattgtgatgattgccgatgaagtg
caaagcggctttgcgcgtaccggtaaactgtttgccatggatcattacgccgataagccg
gacttaatgacgatggcgaaaagcctcgcgggcgggatgccgctttcgggcgtggtcggt
aacgcgaatattatggacgcgcccgcgccgggcgggttgggtggcacctacgccgggaac
ccgctggcggtggctgccgcgcacgcggtgctcaatattatcgacaaagaatcactctgc
aaacgcgcgaatcaactgggccagcgtctcaaaaacacgttgattgatgccaaagaaagc
gttccggccattgctgcggtacgcggcctggggtcgatgattgcggcagagtttaacgat
ccgcaaacgggcgagccgtcagcggcgattgcacagaaaatccagcaacgcgcgctggcg
caggggctgctcctgctgacctgtggcgcatacggcaacgtgattcgcttcctgtatccg
ctgaccatcccggatgcgcaattcgatgcggcaatgaaaattttgcaggatgcgctgagc
gattaa

DBGET integrated database retrieval system