KEGG   Escherichia coli O9 HS (commensal): EcHS_A1578Help
Entry
EcHS_A1578        CDS       T00591                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase GadB
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00250  Alanine, aspartate and glutamate metabolism
ecx00410  beta-Alanine metabolism
ecx00430  Taurine and hypotaurine metabolism
ecx00650  Butanoate metabolism
ecx01100  Metabolic pathways
ecx01110  Biosynthesis of secondary metabolites
ecx01120  Microbial metabolism in diverse environments
ecx02024  Quorum sensing
Module
ecx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EcHS_A1578 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EcHS_A1578 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EcHS_A1578 (gadB)
   00430 Taurine and hypotaurine metabolism
    EcHS_A1578 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EcHS_A1578 (gadB)
Enzymes [BR:ecx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     EcHS_A1578 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 PRTase_3
Motif
Other DBs
NCBI-ProteinID: ABV05904
LinkDB All DBs
Structure
PDB: 

Position
complement(1587470..1588870)
Genome map
AA seq 466 aa AA seqDB search
MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL
ATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
GPYEFICTGRPDEGIPAVCFKLKEGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggataagaagcaagtaacggatttaaggtcggaactactcgattcacgttttggtgcg
aagtctatttccactatcgcagaatcaaaacgttttccgctgcacgaaatgcgcgacgat
gtcgcatttcagattatcaatgacgaattatatcttgatggcaacgctcgtcagaacctg
gccactttctgccagacctgggacgacgacaatgtccacaagttgatggatttatccatt
aacaaaaactggatcgacaaagaagaatatccgcaatccgcagccatcgacctgcgttgc
gtaaatatggttgccgatctgtggcatgcgcctgcgccgaaaaatggtcaggccgttggc
accaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatgaaatggcgt
tggcgcaagcgtatggaagctgcaggcaaaccaacggataaaccgaacctggtgtgcggt
ccggtacaaatctgctggcataaattcgcccgctactgggatgtggagctgcgtgagatc
cctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcctgcgacgaa
aacaccatcggcgtggtgccgactttcggcgtgacctacaccggtaactatgagttcccg
cagccgctgcacgatgcgctggataaattccaggccgacaccggtatcgacatcgacatg
cacatcgacgctgccagcggtggcttcctggcaccgttcgtcgccccggatatcgtctgg
gacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattcggtctggct
ccgctgggctgcggctgggttatctggcgtgacgaagaagcgctgccgcaggaactggtg
ttcaacgttgactacctgggtggtcagattggtacttttgccatcaacttctcccgcccg
gcgggtcaggtaattgcacagtactatgaattcctgcgcctcggtcgtgaaggctatacc
aaagtacagaacgcctcttaccaggttgccgcttatctggcggatgaaatcgccaaactg
gggccgtatgagttcatctgtaccggtcgcccggacgaaggcatcccggcggtttgcttc
aaactgaaagagggtgaagatccgggatacaccctgtacgacctctctgaacgtctgcgt
ctgcgcggctggcaggttccggccttcactctcggcggtgaagccaccgacatcgtggtg
atgcgcattatgtgccgtcgcggcttcgaaatggactttgctgaactgttgctggaagac
tacaaagcctccctgaaatatctcagcgatcacccgaaactgcagggtattgcccaacag
aacagctttaaacatacctga

DBGET integrated database retrieval system