KEGG   Escherichia coli O9 HS (commensal): EcHS_A4590Help
Entry
EcHS_A4590        CDS       T00591                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx00053  Ascorbate and aldarate metabolism
ecx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    EcHS_A4590
Enzymes [BR:ecx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     EcHS_A4590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N AdoHcyase_NAD 2-Hacid_dh_C Pyr_redox_2 HI0933_like Sacchrp_dh_NADP Pyr_redox_3 FAD_binding_3 NAD_binding_7 TrkA_N Pyr_redox NAD_binding_8 FAD_binding_2 Shikimate_DH GIDA UDPG_MGDP_dh_N Thi4 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ABV08741
LinkDB All DBs
Position
4599302..4600324
Genome map
AA seq 340 aa AA seqDB search
MSTMNVLICQQPKELVWKQREIPIPGDNEALIKIKSVGICGTDIHAWGGNQPFFSYPRVL
GHEICGEIVGLGKNIADLKNGQQVAVIPYVACQQCPACKSGRTNCCEKISVIGVHQDGGF
SEYLSVPVANILPADGIDPQAAALIEPFAISAHAVRRAAIAPGEQVLVVGAGPIGLGAAA
IAKADGAQVVVADTSPARREHVATRLELPLLDPSAEDFDAQLRAQFGGSLAQKVIDATGN
QHAMNNTVNLIRHGGTVVFVGLFKGELQFSDPEFHKKETTMMGSRNATPEDFAKVGRLMA
EGKITADMMLTHRYPFATLAETYERDVINNRELIKGVITF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgatgaatgttttaatttgccagcagccgaaagaattagtctggaaacaacgc
gagatacctattccgggtgacaatgaagcattaataaaaattaagtctgtcgggatttgc
ggtaccgatattcatgcctggggtggaaatcaaccattttttagttatccacgtgtttta
ggccatgaaatatgtggggagattgttgggctgggtaaaaatattgctgatcttaaaaat
ggtcagcaagttgctgtgatcccttatgttgcctgtcagcaatgcccggcgtgtaaaagc
gggcgtaccaattgctgtgaaaaaatttcagtcattggcgtgcatcaggatggcggtttt
agtgagtatttgagcgtgccggtggcgaacattttgcccgcagacggtattgacccgcag
gcggccgcattgattgaacctttcgctattagcgctcatgcggtgcgtcgcgcagccatt
gctcccggcgagcaggtgctggtggtcggggcggggccaatcggtttgggcgcggcggca
atcgctaaagccgatggcgcacaggtggtggtggcggataccagtccggcgcgccgtgaa
catgtggcaacgcgtctggaattacctttactggacccgtcagccgaagattttgacgcg
cagctacgggcgcagtttggtggttcgctggcgcagaaagtgatcgacgcgacaggtaat
caacatgcgatgaataacaccgtgaatttgattcgtcacggcggcacggtggtatttgtc
ggcctgtttaaaggtgagttgcagttctccgatccggaattccataaaaaagaaacgacg
atgatgggcagccgcaacgccacgccggaagattttgctaaagtcggtcgactgatggcg
gaaggaaaaatcactgccgacatgatgttaacccatcgctatccgttcgccacgctggca
gaaacctacgagcgcgatgtgattaacaatcgtgagttgattaagggtgtaattactttc
tga

DBGET integrated database retrieval system