KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0783Help
Entry
ECSE_0783         CDS       T00784                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00020  Citrate cycle (TCA cycle)
ecy00190  Oxidative phosphorylation
ecy00650  Butanoate metabolism
ecy01100  Metabolic pathways
ecy01110  Biosynthesis of secondary metabolites
ecy01120  Microbial metabolism in diverse environments
ecy01130  Biosynthesis of antibiotics
ecy01200  Carbon metabolism
Module
ecy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECSE_0783
   00650 Butanoate metabolism
    ECSE_0783
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECSE_0783
Enzymes [BR:ecy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECSE_0783
    1.3.5.4  fumarate reductase (quinol)
     ECSE_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: BAG76307
UniProt: B6I7Z5
LinkDB All DBs
Structure
PDB: 

Position
838375..840141
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGALRDASESDVEASLDRLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccagtcagagaatttgatgcagttgtgattggtgccggtggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggtcaaacctgtgcgctgctctctaaagtcttc
ccgacccgttcccataccgtttctgcgcaaggcggcattaccgttgcgctgggtaatacc
catgaagataactgggaatggcatatgtacgacaccgtaaaaggttcggactatatcggt
gaccaggacgcgattgaatatatgtgtaaaaccgggccggaagcgattctggaactcgaa
cacatgggcctgccgttctcgcgtcttgatgatggtcgtatctatcaacgtccgtttggc
ggtcagtcgaaaaacttcggcggcgagcaggcggcacgcactgcggcagcagctgaccgt
accggtcacgcactgttgcataccctttatcagcagaacctgaaaaaccacaccactatt
ttctccgagtggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtgggttgt
actgcactgtgcatcgaaactggtgaagtggtttatttcaaagcccgcgctaccgtgctg
gcgactggcggggcagggcgtatttatcagtccaccactaacgcccacattaacactggc
gacggcgtcggcatggctatccgcgcaggcgtaccggtgcaggatatggaaatgtggcag
ttccacccgaccggtattgccggtgcgggcgtactggtcaccgaaggttgccgtggtgaa
ggcggttatctgctgaacaaacatggcgaacgctttatggagcgttatgcgccgaacgcc
aaagacctggcgggccgtgatgtggtggcgcgttccatcatgatcgaaatccgtgaaggt
cgcggctgtgatggtccgtgggggccacatgcgaaactgaaactcgaccacctgggtaaa
gaagttctcgaatcccgtctgccgggtattctggaactctcccgtaccttcgctcacgtt
gatccggtgaaagagccgattccggttatcccaacctgtcactacatgatgggtggtatt
ccgaccaaagtgaccggtcaggcgctgacggtgaacgagaaaggcgaagatgtggttgtt
ccggggctgtttgccgttggtgaaatcgcttgtgtatcggtacacggcgctaaccgtctg
ggcggcaactcgctgctggacctggtggtctttggtcgcgcagcgggtctgcatctgcaa
gagtctatcgccgagcagggcgcattgcgcgatgccagcgagtctgatgttgaagcatct
ctggatcgtctgaaccgctggaacaataatcgtaacggtgaagatccggtggcgattcgt
aaagcgctgcaagaatgtatgcagcataacttctcggtcttccgtgaaggtgatgcgatg
gcgaaagggcttgagcagttgaaagttatccgcgagcgtctgaaaaatgcccgtctggat
gacacttccagcgagttcaacacccagcgcgttgagtgcctggaactggataacctgatg
gaaacggcgtatgcaacggctgtttctgccaacttccgtaccgaaagccgtggcgcgcat
agccgcttcgacttcccggatcgtgatgatgaaaactggctgtgccactccctgtatctg
ccagagtcggaatccatgacgcgccgaagcgtcaacatggaaccgaaactgcgcccggca
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system