KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0784Help
Entry
ECSE_0784         CDS       T00784                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00020  Citrate cycle (TCA cycle)
ecy00190  Oxidative phosphorylation
ecy00650  Butanoate metabolism
ecy01100  Metabolic pathways
ecy01110  Biosynthesis of secondary metabolites
ecy01120  Microbial metabolism in diverse environments
ecy01130  Biosynthesis of antibiotics
ecy01200  Carbon metabolism
Module
ecy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECSE_0784
   00650 Butanoate metabolism
    ECSE_0784
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECSE_0784
Enzymes [BR:ecy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECSE_0784
    1.3.5.4  fumarate reductase (quinol)
     ECSE_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: BAG76308
UniProt: B6I7Z6
LinkDB All DBs
Structure
PDB: 

Position
840157..840873
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgagttttcaatttatcgctataacccggatgttgatgatgctccgcgtatg
caggattacaccctggaagcggaagaaggtcgcgacatgatgttgctggatgcgcttatc
cagctgaaagagaaagatcccagcctgtcgttccgccgctcctgccgtgaaggtgtgtgc
ggttccgacggtctgaacatgaacggcaagaatggtctggcctgtattaccccgatttcg
gcactcaaccagccgggcaagaagattgtgattcgcccgctgccaggtttaccggtgatc
cgcgatttggtggtagacatgggacaattctatgcgcaatatgagaaaattaagccttac
ctgttgaataatggacaaaatccgccagctcgcgagcatttacagatgccagagcagcgc
gaaaaactcgacgggctgtatgaatgtattctctgcgcatgttgttcaacctcttgtccg
tctttctggtggaatcccgataagtttatcggcccggcaggcttgttagcggcatatcgt
ttcctgatcgatagccgtgataccgagactgacagccgcctcgacggtttgagcgatgca
ttcagtgtattccgctgtcacagcatcatgaactgcgtcagtgtatgtccgaaggggctg
aacccgacgcgcgccatcggccatatcaagtcgatgttgttgcaacgtaatgcgtaa

DBGET integrated database retrieval system