KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0809Help
Entry
ECSE_0809         CDS       T00784                                 

Definition
(GenBank) galactose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00010  Glycolysis / Gluconeogenesis
ecy00052  Galactose metabolism
ecy01100  Metabolic pathways
ecy01110  Biosynthesis of secondary metabolites
ecy01120  Microbial metabolism in diverse environments
ecy01130  Biosynthesis of antibiotics
Module
ecy_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECSE_0809
   00052 Galactose metabolism
    ECSE_0809
Enzymes [BR:ecy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     ECSE_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAG76333
UniProt: B6I7R0
LinkDB All DBs
Position
complement(869860..870900)
Genome map
AA seq 346 aa AA seqDB search
MLNETPALAPDGQPYRLLTLRNNAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPE
CYQDQAAFLGASIGRYANRIANSRYTFDGETVTLSPSQGVNQLHGGPEGFDKRRWQIVNQ
NDRQVLFALSSDDGDQGFPGNLGATVQYRLTDDNRISITYRATVDKPCPVNMTNHVYFNL
DGEQSDVRNHKLQILADEYLPVDEGGIPHDGLKSVAGTSFDFRSAKIIASEFLADDDQRK
VKGYDHAFLLQAKGDGKKVAAHVWSADEKLQLKVYTTAPALQFYSGNFLGGTPSRGTEPY
ADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTEYQFIAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaacgaaactcccgcactggcacccgatggtcagccgtaccgactgttaactttg
cgtaacaacgcagggatggtagtcacgctgatggactggggtgcgactttactttcagct
cgtattccgctttccgatggcagcgtccgcgaggcgctgctcggctgtgccagcccggaa
tgctatcaggatcaggctgcgtttctgggggcctctattggtcgttatgccaaccgcatc
gccaatagccgttatacctttgacggtgaaaccgtgacgctttcgccaagtcagggcgtt
aaccagctgcacggcggcccggaagggttcgacaaacgtcgctggcagattgtgaaccag
aacgatcgtcaggtgctgtttgccctgagttcagatgatggcgatcagggcttcccgggt
aatctcggcgcgacggtgcaatatcgtctgaccgacgataaccgtatctctattacttat
cgcgccacagttgataaaccttgcccggtgaatatgactaatcacgtctatttcaatctt
gacggcgagcagtctgacgtgcgcaatcacaagttgcagattctggcggacgaatatctg
ccggttgatgaaggcggcattccgcacgacggcctgaaatctgtcgccggaacgtctttt
gatttccgtagcgccaaaatcatcgccagtgagtttcttgccgacgacgatcagcgcaaa
gtgaaaggttacgatcacgcattcttgttacaggccaaaggcgatggcaagaaagtggcg
gcgcatgtctggtcagcagatgaaaaattgcagctgaaggtctacaccaccgctccggct
ctgcaattctactccggcaacttcctcggcggcacgccatcaagaggaactgaaccttac
gccgactggcaaggcctggcactggaaagcgagtttctgccggacagcccaaaccaccct
gaatggccgcaaccggactgcttcctgcgtcctggcgaagagtattccagcctgacggaa
tatcagtttattgctgagtag

DBGET integrated database retrieval system