KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_0897Help
Entry
ECSE_0897         CDS       T00784                                 

Definition
(GenBank) penicillin-binding protein 6
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00550  Peptidoglycan biosynthesis
ecy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECSE_0897
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ecy01002]
    ECSE_0897
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecy01011]
    ECSE_0897
Enzymes [BR:ecy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECSE_0897
Peptidases [BR:ecy01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ECSE_0897
Peptidoglycan biosynthesis and degradation proteins [BR:ecy01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ECSE_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: BAG76421
UniProt: B6I8F9
LinkDB All DBs
Structure
PDB: 

Position
964623..965825
Genome map
AA seq 400 aa AA seqDB search
MTQYSSLLRGLAAGSAFLFLFAPTAFAAEQTVEAPSVDARAWILMDYASGKVLAEGNADE
KLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWATGNPALRGSSVMFLKPGDQVS
VADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTFQTVHGLDAPGQ
FSTARDMALLGKALIHDVPEEYAIHKEKEFTFNKIRQPNRNRLLWSSNLNVDGMKTGTTA
GAGYNLVASATQGDMRLISVVLGAKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFVTQ
RVWFGDKSEVNLGAGEAGSVTIPRGQLKNLKASYTLTEPQLTAPLKKGQVVGTIDFQLNG
KSIEQRPLIVMENVEEGGFFGRMWDFVMMKFHQWFGSWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatactcctctctccttcgtggtcttgcagcgggttctgcatttttattcctt
tttgccccaacggcattcgcggcggaacaaaccgttgaagcgccgagcgtggatgcgcgt
gcatggattttaatggattacgccagcggtaaagtgctggcagaaggcaacgcggatgag
aaactggatcccgcgagcctgactaaaatcatgaccagctatgtggttgggcaggcgctt
aaggccgataagattaaactcaccgatatggtgacggtcggtaaagatgcctgggcgacg
ggaaatccggcactgcgtggttcatcggtaatgttcctcaaaccgggcgatcaggtttcg
gtggcagacttgaacaaaggtgtgattatccagtccggtaatgacgcctgtattgcgctg
gctgattacgttgccgggagccaggagtcatttattggtctgatgaatggttatgccaaa
aaactgggtctgaccaacactaccttccagacggtgcacggcctggatgcgccggggcag
ttcagcaccgcgcgcgatatggcattgctgggtaaagcattgatccacgatgtgccggaa
gagtacgccattcataaagagaaagagttcaccttcaacaaaattcgtcagcctaaccgt
aaccgtctgctgtggagcagcaatctgaatgttgatggcatgaagacaggaaccacggca
ggcgcgggatataatctggttgcttcggctacccagggcgatatgcgtttaatctccgta
gtgttgggggcgaaaaccgaccgtatccgttttaatgagtctgagaaattattgacctgg
ggtttccgcttctttgaaaccgtgacgccaattaaacctgatgccacctttgtgactcag
cgcgtctggtttggtgataagagcgaagtgaatctcggggcaggtgaagcgggctcagtg
accataccgcgtgggcagctgaaaaacctgaaagcgagttatacgttaacggaaccgcag
cttaccgcaccgctgaaaaaaggtcaggttgtcgggaccattgatttccagcttaacggt
aaatccattgagcagcgtccgctgatcgtgatggaaaatgtggaagagggcggattcttt
ggtcggatgtgggatttcgtgatgatgaaattccatcagtggttcggcagctggttctct
taa

DBGET integrated database retrieval system