KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_2360
Entry
ECSE_2360         CDS       T00784                                 

Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00052  Galactose metabolism
ecy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECSE_2360
Enzymes [BR:ecy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     ECSE_2360
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 3HCDH_N Shikimate_DH 2-Hacid_dh_C UDPG_MGDP_dh_N PrmA Methyltransf_25 ELFV_dehydrog FAD_binding_2 TrkA_N ThiF MTS
Other DBs
NCBI-ProteinID: BAG77884
UniProt: B6HYT2
LinkDB
Structure
PDB: 
4UEJ 4A2C 4UEK 4UEO

Position
complement(2425927..2426967)
AA seq 346 aa
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFDLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgatggtatcgtgcgcgttgcagaaagcgtcattcct
gaaattaaacatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttaggccatgaa
tttagcggctatattgatgcggtgggatccggtgttgatgatttacatcctggcgatgcg
gttgcctgtgtgccgttattaccctgttttacttgtccagagtgtttgaaagggttttat
tcccagtgcgcaaaatatgattttattggctcacggcgtgatggtggatttgccgaatat
attgtcgttaagcggaaaaatgtctttgctctacctactgatatgcctattgaggatggg
gcttttattgaaccgattaccgttggcttgcatgcttttgatttagcgcaaggttgtgag
aataaaaacgtaattattattggtgccggaaccattggcctgctggccattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggcgatcgacattagttcagaaaaactggcactg
gcaaaatctttcggtgcgatgcaaacatttaacagtagcgaaatgagcgcgccgcaaatg
cagagcgttttacgcgaactgcgctttaatcagcttatcctcgagacggctggcgtaccg
caaactgtcgaactggcggtagagattgccggtcctcatgcccaactggcgctggtgggc
acgttgcatcaggatctgcatttaacatcggcaacgtttggcaaaatattgcgtaaagag
ctgacggttatcggcagttggatgaactactccagcccttggccggggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaaagcttcgcccaggcggtgcgtgacatcgctcgtaatgctatgccgggc
aaagtgttgctcattccctga

DBGET integrated database retrieval system