KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_2915Help
Entry
ECSE_2915         CDS       T00784                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Pathway
ecy00250  Alanine, aspartate and glutamate metabolism
ecy00280  Valine, leucine and isoleucine degradation
ecy00310  Lysine degradation
ecy00410  beta-Alanine metabolism
ecy00640  Propanoate metabolism
ecy00650  Butanoate metabolism
ecy01100  Metabolic pathways
ecy01120  Microbial metabolism in diverse environments
Module
ecy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECSE_2915
   00650 Butanoate metabolism
    ECSE_2915
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECSE_2915
   00280 Valine, leucine and isoleucine degradation
    ECSE_2915
   00310 Lysine degradation
    ECSE_2915
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECSE_2915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecy01007]
    ECSE_2915
Enzymes [BR:ecy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECSE_2915
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECSE_2915
    2.6.1.48  5-aminovalerate transaminase
     ECSE_2915
Amino acid related enzymes [BR:ecy01007]
 Aminotransferase (transaminase)
  Class III
   ECSE_2915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAG78439
UniProt: B6I653
LinkDB All DBs
Structure
PDB: 

Position
3026752..3028032
Genome map
AA seq 426 aa AA seqDB search
MNSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAASPAFMQRLRALCDEHGLMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FDEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaggtggtggccgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
ttcgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtaaaa
atcgcccgcgccgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgatgccgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgtcgccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggctcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatcttaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtaatggatgccgtcgctccaggcggtctgggcggcacctatgcgggt
aacccgattgcctgcgtggctgcgctggaagtgttgaaggtgtttgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaagttgaaagacggattgctggcaatagccgaa
aaacacccggagatcggcgacgtacgcgggctgggggcgatgatcgccattgagctgttt
gaagacggcgatcacaacaagccggacgccaaactcaccgccgagatcgtggctcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgatgaggcgaagcagtag

DBGET integrated database retrieval system