KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0369Help
Entry
ECS88_0369        CDS       T00830                                 

Gene name
ampH
Definition
(GenBank) beta-lactamase/D-alanine carboxypeptidase
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ecz01002]
    ECS88_0369 (ampH)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecz01011]
    ECS88_0369 (ampH)
Enzymes [BR:ecz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECS88_0369 (ampH)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     ECS88_0369 (ampH)
Peptidases [BR:ecz01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   ECS88_0369 (ampH)
Peptidoglycan biosynthesis and degradation proteins [BR:ecz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ECS88_0369 (ampH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: CAR01719
UniProt: B7MD34
LinkDB All DBs
Position
complement(398734..399891)
Genome map
AA seq 385 aa AA seqDB search
MKRSLLFSAVLYAASLTSVHAAQPITEPEFASDIVDRYADHIFYGSGATGMALVVIDGNQ
RVFRSYGETRPGNNVRPQLDSVIRIASLTKLMTSEMLVKLLDQGTVKLNDPLSKYAPPGA
RVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWKYLSTAKLKAAPGSQ
AAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTYTPSPDQCRRLMVAERGAS
PCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQADRMQTLIYQRAQFTKVIGMD
VPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAMIPQKNIGAFVVVTRSPLTRF
KNMSDGINDLVTELSGNKPLVIPAS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgtagtctgcttttttctgccgtgctgtatgcggcgtcattgacctccgtccat
gcggcgcagccgatcactgaaccggagtttgcctctgatattgtcgatcgttatgccgat
catattttttacggcagcggtgccacggggatggcgctggttgttatcgacggtaaccag
cgcgtctttcgcagttatggcgaaacgcgacctggtaataacgttcgcccgcagctggat
tccgtcatacgtattgcttccctcaccaagttaatgaccagtgagatgctggtgaaattg
ctcgaccaggggaccgtgaagttaaacgatccgctaagtaaatatgctccgccaggcgca
cgcgtaccgacctacaatgggacgcccattacgctggtgaatctggcaacccataccagc
gccctgccccgtgaacagcccggtggcgcggcacatcgtccggtatttgtctggccaacg
cgcgagcaacgctggaaatacctttccactgccaaactaaaagccgcgccgggcagccag
gccgcgtactccaacctcgcattcgatctgctggcagatgcactggcgaatgcgtccggc
aagccttatacccagttgtttgaagagcagattacccgtccgttggggatgaaagacacc
acctacaccccctcaccggatcagtgccgccgtttaatggttgctgagcgcggtgccagt
ccgtgcaataacacgctggcggcaattggcagcggcggcgtctattccacgccaggcgat
atgatgcgctggatgcagcagtatttgtcatctgatttttatcagcgcagtaaccaggct
gatcgcatgcagacgttgatttatcagcgcgcgcagtttacaaaagtgattggcatggat
gtccccggcaaagcggatgcgcttggtttaggctgggtatatatggccccgaaagagggt
cgtccggggattattcagaagacaggtggtggtggcggtttcattacctatatggcgatg
atcccgcagaagaatattggcgcgtttgtggtggtcactcgttcgccgttgacgcgcttt
aaaaatatgagcgatggcatcaatgacctggtgaccgagctaagcgggaataaaccgttg
gttatccccgcatcctga

DBGET integrated database retrieval system