KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_0486Help
Entry
ECS88_0486        CDS       T00830                                 

Gene name
ybaS
Definition
(GenBank) amidase, possibly glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00220  Arginine biosynthesis
ecz00250  Alanine, aspartate and glutamate metabolism
ecz00471  D-Glutamine and D-glutamate metabolism
ecz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECS88_0486 (ybaS)
   00220 Arginine biosynthesis
    ECS88_0486 (ybaS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ECS88_0486 (ybaS)
Enzymes [BR:ecz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ECS88_0486 (ybaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CAR01832
UniProt: B7ME10
LinkDB All DBs
Structure
PDB: 

Position
516450..517382
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQTYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTSDGNVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKVGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENTEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLINTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEEGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcagacttacacccaatttcactca
cttaacggcggacaaaatgccgattacattccctttctggcgaatgtccctggtcaactg
gcggcagtggctatcgtgaccagcgatggcaacgtctatagtgcgggtgacagtgattac
cgctttgcgctggaatccatctcgaaagtctgtacgttagcccttgcgttagaagatgtc
ggcccgcaggcggtacaggacaaagttggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgct
attgccaccaccagcctgattaacgctgaaaatactgaacaacgctggcagcgaatttta
catatccaacaacaactggctggtgagcaggtagcgctctctgatgaagtcaaccagtcg
gaacaaacaaccaacttccataaccgggccattgcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtacacccgtcagtgctccacgctcatc
aatactattgaactggcaacgcttggcgcgacgctggcggcgggtggtgtgaatccgctg
acgcataaacgcgttcttcaggccgacaatgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcgtatcgcgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgttcctggcgtgatgggaattgccgcgttttca
ccaccgctggatgaagaaggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system