KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_1690Help
Entry
ECS88_1690        CDS       T00830                                 

Gene name
slyA
Definition
(GenBank) DNA-binding transcriptional activator
  KO
K06075  MarR family transcriptional regulator, transcriptional regulator for hemolysin
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecz03000]
    ECS88_1690 (slyA)
Transcription factors [BR:ecz03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    ECS88_1690 (slyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_Crp_2 B-block_TFIIIC HTH_20 HxlR HTH_5 HTH_24 TrmB DUF4423 HTH_36 LexA_DNA_bind Replic_Relax GntR RP-C GlnD_UR_UTase RsbU_N DUF2250 Fe_dep_repress
Motif
Other DBs
NCBI-ProteinID: CAR03003
UniProt: B7M9Z6
LinkDB All DBs
Position
complement(1688984..1689418)
Genome map
AA seq 144 aa AA seqDB search
MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQ
PSLVRTLDQLEEKGLISRQTCASDRRAKRIKLTEKAEPLISEMEAVINKTRAEILHGISA
EELEQLIKLIAKLEHNIIELQAKG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
ttggaatcgccactaggttctgatctggcacggttggtgcgcatatggcgtgctctgata
gaccatcgcctgaaaccgctggagttaacacaaacccattgggttacgttacacaatatc
catcagttacctccagaccagtcgcaaattcaactggcaaaagcgattggcatcgagcag
ccatcactggtccgtacgctggaccaactggaagaaaaagggttaatttcgcgtcaaact
tgtgccagcgatcgtcgggctaaacgtattaaactgacggaaaaggcagagccactgatc
agcgaaatggaggctgttattaacaaaacccgcgcggaaattttacatggcatctccgca
gaggaactggaacaactgattaagctcatcgcaaaacttgagcataatatcattgagtta
caggccaaagggtga

DBGET integrated database retrieval system