KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_1857
Entry
ECS88_1857        CDS       T00830                                 

Gene name
fadD
Definition
(GenBank) acyl-CoA synthetase (long-chain-fatty-acid--CoA ligase)
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00061  Fatty acid biosynthesis
ecz00071  Fatty acid degradation
ecz01100  Metabolic pathways
ecz01212  Fatty acid metabolism
ecz02024  Quorum sensing
Module
ecz_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECS88_1857 (fadD)
   00071 Fatty acid degradation
    ECS88_1857 (fadD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECS88_1857 (fadD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecz01004]
    ECS88_1857 (fadD)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecz04147]
    ECS88_1857 (fadD)
Enzymes [BR:ecz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     ECS88_1857 (fadD)
Lipid biosynthesis proteins [BR:ecz01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   ECS88_1857 (fadD)
Exosome [BR:ecz04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   ECS88_1857 (fadD)
  Exosomal proteins of breast cancer cells
   ECS88_1857 (fadD)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C Pept_S41_N AMP-binding_C_2
Other DBs
NCBI-ProteinID: CAR03163
UniProt: B7MBL1
LinkDB
Position
complement(1843183..1844868)
AA seq 561 aa
MKKVWLNRYPADVPTEINPDRYQSLVDMFEQSVARYADQPAFVNMGEVMTFRKLEERSRA
FAAYLQQGLGLKKGDRVALMMPNLLQYPVALFGILRAGMIVVNVNPLYTPRELEHQLNDS
GASAIVIVSNFAHTLEKVVDKTAVQHVILTRMGDQLSTAKGTVVNFVVKYIKRLVPKYHL
PDAISFRSALHNGYRMQYVKPELVPEDLAFLQYTGGTTGVAKGAMLTHRNMLANLEQVNA
TYGPLLHPGKELVVTALPLYHIFALTINCLLFIELGGQNLLITNPRDIPGLVKELAKYPF
TAITGVNTLFNALLNNKEFQQLDFSSLHLSAGGGMPVQQVVAERWVKLTGQYLLEGYGLT
ECAPLVSVNPYDIDYHSGSIGLPVPSTEAKLVDDDDNEVPPGQPGELCVKGPQVMLGYWQ
RPDATDEIIKNGWLHTGDIAVMDEEGFLRIVDRKKDMILVSGFNVYPNEIEDVVMQHPGV
QEVAAVGVPSGSSGEAVKIFVVKKDPSLTEESLVTFCRRQLTGYKVPKLVEFRDELPKSN
VGKILRRELRDEARGKVDNKA
NT seq 1686 nt   +upstreamnt  +downstreamnt
ttgaagaaggtttggcttaaccgttatcccgcggacgttccgacggagatcaaccctgac
cgttatcaatctctggtagatatgtttgagcagtcggtcgcgcgctacgccgatcaaccc
gcgtttgtgaatatgggggaggtgatgaccttccgcaaactggaagaacgcagtcgcgcg
tttgccgcttatttgcaacaagggttggggctgaagaaaggcgatcgcgttgcgttgatg
atgcctaacttattgcaatatccggtggcgctgtttggcattttgcgtgccgggatgatc
gtcgtaaacgttaacccgttgtataccccgcgtgagcttgagcatcagcttaacgatagc
ggcgcatcggcgattgttatcgtgtctaactttgcccacactctggaaaaagtggttgat
aaaaccgccgttcagcacgttattctgacccgtatgggcgatcagctatctacggcaaaa
ggcacggtagtcaatttcgttgttaaatacatcaagcgtctggtgccgaaataccatctg
ccagatgccatttcatttcgtagcgccctgcacaacggctaccggatgcagtatgtcaaa
ccagaactggtgccggaagatttagctttcctgcaatacaccggcggcaccactggtgtg
gcgaaaggcgcgatgctgactcaccgcaatatgctggcgaacctggaacaggttaacgcg
acctatggtccgctgttgcatccgggcaaagagctggtggtgacggcgctgccgctgtat
cacatttttgccctgaccattaactgcctgctgtttatcgaactgggtgggcagaacctg
cttatcactaacccgcgcgatattccagggttggtaaaagagttagcgaaatatccgttt
accgctatcactggcgttaacaccttgttcaatgcgttgctgaacaataaagagttccag
cagctggatttctccagtctgcatctttccgcaggcggagggatgcctgttcagcaagtg
gtggcagaacgttgggtgaaactgactggacagtatctgctggaaggttatggcctgacc
gagtgtgcgccgctggtcagcgttaacccgtatgatattgattatcatagtggtagcatc
ggtttaccggtgccgtcgacggaagccaaactggtggatgatgatgataatgaagtacca
ccgggtcaaccaggtgagctttgtgtcaaaggaccgcaggtgatgctgggttactggcag
cgtccggatgctaccgatgaaatcatcaaaaatggctggttacacaccggcgacatcgcg
gtgatggatgaagaaggattcctgcgcattgtcgatcgcaaaaaagacatgattctggtt
tccggttttaacgtctatcccaacgagattgaagatgtcgtcatgcagcatcctggcgta
caggaagtcgcggctgttggcgtaccttctggctccagtggtgaagcggtgaaaatcttc
gtagtgaaaaaagatccatcgcttaccgaagagtcactggtgactttttgccgccgtcag
ctcacgggctacaaagtaccgaagctggtggagtttcgtgatgagttaccgaaatctaac
gtcggaaaaattttgcgacgagaattacgtgacgaagcgcgcggcaaagtggacaataaa
gcctga

DBGET integrated database retrieval system