KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_2926Help
Entry
ECS88_2926        CDS       T00830                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase, PLP-dependent
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00250  Alanine, aspartate and glutamate metabolism
ecz00280  Valine, leucine and isoleucine degradation
ecz00310  Lysine degradation
ecz00410  beta-Alanine metabolism
ecz00640  Propanoate metabolism
ecz00650  Butanoate metabolism
ecz01100  Metabolic pathways
ecz01120  Microbial metabolism in diverse environments
Module
ecz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECS88_2926 (gabT)
   00650 Butanoate metabolism
    ECS88_2926 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECS88_2926 (gabT)
   00280 Valine, leucine and isoleucine degradation
    ECS88_2926 (gabT)
   00310 Lysine degradation
    ECS88_2926 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECS88_2926 (gabT)
Enzymes [BR:ecz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECS88_2926 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECS88_2926 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     ECS88_2926 (gabT)
Amino acid related enzymes [BR:ecz01007]
 Aminotransferase (transaminase)
  Class III
   ECS88_2926 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAR04173
UniProt: B7MKD3
LinkDB All DBs
Structure
PDB: 

Position
2879932..2881212
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHTEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAEIVARARDKGLILLSCGPYNNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaagtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatcttgaactgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaactctgctggttacgaccggttccgaagcggtggaaaatgcggtgaaa
atcgcccgcgccgccactaaacgtagcggtactatcgcctttagcggtgcgtatcacggg
cgcacgcattacacactggcgctgaccggcaaggtgaatccatactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaagatatc
gccgccatcgtgattgagcccgttcagggcgaaggcggtttctacgccgcgacgccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcaaatgggcgtggca
ccagatctcaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggcggtctgggcggcacctatgccggt
aacccgattgcctgcgtagcggcgctggaagtgttaaaagtgtttgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaaactgaaagacggattgctggcgatagccgaa
aaacatactgagatcggcgacgtacgcgggctgggagcgatgattgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgccaaactcaccgccgagatcgtggcgcgtgcc
cgcgataaaggcctgattcttctctcctgcggcccgtataacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system