KEGG   Escherichia coli DH1: EcDH1_0779Help
Entry
EcDH1_0779        CDS       T01996                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
edh  Escherichia coli DH1
Pathway
edh00030  Pentose phosphate pathway
edh01100  Metabolic pathways
edh01110  Biosynthesis of secondary metabolites
edh01120  Microbial metabolism in diverse environments
edh01130  Biosynthesis of antibiotics
edh01200  Carbon metabolism
edh01230  Biosynthesis of amino acids
Module
edh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
edh_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:edh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EcDH1_0779
Enzymes [BR:edh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     EcDH1_0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: ACX38463
LinkDB All DBs
Structure
PDB: 

Position
824438..825097
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KSLGIHVFDLNEVDSLGIYVDGADEINGHMQMIKGGGAALTREKIIASVAEKFICIADAS
KQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVHGMEILDPI
AMENAINAIPGVVTVGLFANRGADVALIGTPDGVKTIVK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgaattgaaaaaagcagtaggatgggcggcacttcagtatgttcagccc
ggcaccattgttggtgtaggtacaggttccaccgccgcacactttattgacgcgctcggt
acaatgaaaggccagattgaaggggccgtttccagttcagatgcttccactgaaaaactg
aaaagcctcggcattcacgtttttgatctcaacgaagtcgacagccttggcatctacgtt
gatggcgcagatgaaatcaacggccacatgcaaatgatcaaaggcggcggcgcggcgctg
acccgtgaaaaaatcattgcttcggttgcagaaaaatttatctgtattgcagacgcttcc
aagcaggttgatattctgggtaaattcccgctgccagtagaagttatcccgatggcacgt
agtgcagtggcgcgtcagctggtgaaactgggcggtcgtccggaataccgtcagggcgtg
gtgaccgataatggcaacgtgatcctcgacgtccacggcatggaaatccttgacccgata
gcgatggaaaacgccataaatgcgattcctggcgtggtgactgttggcttgtttgctaac
cgtggcgcggacgttgcgctgattggcacacctgacggtgtcaaaaccattgtgaaatga

DBGET integrated database retrieval system