KEGG   Escherichia coli DH1: EcDH1_1931Help
Entry
EcDH1_1931        CDS       T01996                                 

Definition
(GenBank) transport system permease protein
  KO
K06073  vitamin B12 transport system permease protein
Organism
edh  Escherichia coli DH1
Pathway
edh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:edh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EcDH1_1931
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:edh02000]
    EcDH1_1931
Transporters [BR:edh02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Vitamin B12 transporter
    EcDH1_1931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-ProteinID: ACX39588
LinkDB All DBs
Structure
PDB: 

Position
2083326..2084306
Genome map
AA seq 326 aa AA seqDB search
MLTLARQQQRQNIRWLLCLSVLMLLALLLSLCAGEQWISPGDWFTPRGELFVWQIRLPRT
LAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLC
AIAGALIITLILLRFARRHLSTSRLLLAGVALGIICSALMTWAIYFSTSVDLRQLMYWMM
GGFGGVDWRQSWLMLALIPVLLWICCQSRPMNMLALGEISARQLGLPLWFWRNVLVAATG
WMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVLLPGCALAGASALLLADIVARLALAA
AELPIGVVTATLGAPVFIWLLLKAGR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctgacacttgcccgccaacaacagcgacaaaatattcgctggttattatgcctgtca
gttttgatgctgctggcgcttctcttaagcctttgcgccggtgaacaatggatctcgcca
ggtgactggtttactcctcgtggcgaactgttcgtctggcaaattcgcctgccacgtacg
ctggctgtattgctggttggtgcggcgctggctatatccggcgctgtaatgcaggcgttg
tttgaaaatcctctggcagaacctggactacttggcgtctctaacggcgcaggcgtgggg
cttatcgccgcggtattgcttgggcaagggcaactccccaactgggcgctagggctgtgt
gcgattgctggcgcgcttatcatcactttaatactcttacgtttcgcccgtcgtcatctt
tcgaccagtcggttattgctggctggcgttgcattagggattatctgtagcgcactaatg
acgtgggctatctacttttccacctcagttgatttgcgtcagctgatgtactggatgatg
ggcggttttggcggcgtagactggcggcaaagctggctgatgctggcattgatccccgtg
ttgttgtggatctgttgtcagtccaggccgatgaatatgttagcacttggcgagatctcg
gcgcggcaactgggtttacccctgtggttctggcgcaatgtgctggtggcagcgaccggc
tggatggttggcgtcagtgtggcgctggcgggtgctatcggctttattggtctggtgatc
ccccatattctccggttgtgtggtttaaccgatcatcgcgtattacttcccggctgcgcg
ctggcaggggcgagcgcattgctgctggccgatattgtagcgcgcctggcattagctgcc
gcagagctgcctattggcgtggtcaccgcaacgttaggtgcgccggtgtttatctggtta
ttgttaaaagcaggacgttag

DBGET integrated database retrieval system