KEGG   Escherichia coli DH1: EcDH1_2034
Entry
EcDH1_2034        CDS       T01996                                 

Definition
(GenBank) histidine kinase
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
edh  Escherichia coli DH1
Pathway
edh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:edh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EcDH1_2034
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:edh01001]
    EcDH1_2034
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:edh02022]
    EcDH1_2034
Enzymes [BR:edh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     EcDH1_2034
Protein kinases [BR:edh01001]
 Histidine kinases
  OmpR family
   EcDH1_2034
Two-component system [BR:edh02022]
 OmpR family
  RstB-RstA
   EcDH1_2034
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3
Other DBs
NCBI-ProteinID: ACX39691
LinkDB
Position
complement(2194295..2195596)
AA seq 433 aa
MKKLFIQFYLLLFVCFLVMSLLVGLVYKFTAERAGKQSLDDLMNSSLYLMRSELREIPPH
DWGKTLKEMDLNLSFDLRVEPLSKYHLDDISMHRLRGGEIVALDDQYTFLQRIPRSHYVL
AVGPVPYLYYLHQMRLLDIALIAFIAISLAFPVFIWMRPHWQDMLKLEAAAQRFGDGHLN
ERIHFDEGSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
SAAESQALNRDISQLEALIEELLTYARLDRPQNELHLSEPDLPLWLSTHLADIQAVTPDK
TVRIKTLVQGHYAALDMRLMERVLDNLLNNALRYCHSTVETSLLLSGNRATLIVEDDGPG
IAPENREHIFEPFVRLDPSRDRSTGGCGLGLAIVHSIALAMGGTVNCDTSELGGARFSFS
WPLWHNIPQFTSA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaaaaactgtttatccagttttacctgttattgtttgtctgcttccttgtgatgtct
ctgctggttgggctggtgtacaaatttaccgccgaacgcgcgggcaaacagtcgctggat
gatttgatgaacagttcgctgtatctgatgcgcagcgaattgcgtgagatccccccacac
gactggggtaaaactctgaaagagatggatttaaatctctctttcgatctgcgtgtcgag
ccactgagtaaataccatcttgatgatatttccatgcaccgactgcgtggcggcgaaatt
gtcgccctggacgatcagtacacgtttttgcagcgtatcccgcgcagccactacgtgctg
gcagttggtcctgttccttatctttattatctccatcagatgcgattgctggatatcgcc
ctgatcgcttttattgctatttccctcgcctttccggtgtttatctggatgcgtccgcac
tggcaggatatgttaaaactggaagcagcggcgcaacgatttggcgatgggcatctcaat
gaacgtatccactttgatgagggttcgagctttgaacgacttggcgtcgcatttaaccag
atggcggacaatatcaacgccttaattgccagcaaaaaacagcttattgacggtatcgct
cacgaactgcgaacaccgttagtgcgcctgcgttatcgactggagatgagcgataacctg
agcgccgccgaatcccaggcgttgaatcgtgatatcagtcaacttgaagctttaattgaa
gagctgctgacttatgcccgactcgatcgcccacaaaacgagcttcatcttagcgaacca
gacctgccgttgtggctgtcaacgcatctggcagatattcaggcagtaacgcccgataaa
acggtacggataaaaacgctcgtgcaaggccattatgcggcgttggatatgcgcttaatg
gagcgcgtgctggataatttgctcaataacgccctgcggtactgccattcaacggttgaa
accagcctgctactgtcggggaatagagcgacattaattgttgaggatgatggcccaggg
attgccccagaaaaccgcgaacatatctttgaaccttttgttcgcctcgatcccagccgg
gatcgctcaaccggcggctgcgggctggggctggcaattgtccactctatagcactggca
atgggcggtacggttaattgtgacaccagcgaactgggtggtgcccgcttctcgtttagc
tggccgttatggcataacatcccgcaatttacctctgcctga

DBGET integrated database retrieval system