KEGG   Escherichia coli DH1: EcDH1_2411Help
Entry
EcDH1_2411        CDS       T01996                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
edh  Escherichia coli DH1
Pathway
edh00240  Pyrimidine metabolism
edh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    EcDH1_2411
Enzymes [BR:edh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     EcDH1_2411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD AAA_30
Motif
Other DBs
NCBI-ProteinID: ACX40053
LinkDB All DBs
Position
complement(2584334..2584951)
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNSSLFDEIRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDF
RGELFIGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALQVDSLTAIQERHRHD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattccgcaatgaatgcgggtaagtctacagcattgttg
caatcttcatacaattaccaggaacgcggcatgcgcactgtcgtatatacggcagaaatt
gatgatcgctttggtgccgggaaagtcagttcgcgtataggtttgtcatcgcctgcaaaa
ttatttaaccaaaattcatcattatttgatgagattcgtgcggaacatgaacagcaggca
attcattgcgtactggttgatgaatgccagtttttaaccagacaacaagtatatgaatta
tcggaggttgtcgatcaactcgatatacccgtactttgttatggtttacgtaccgatttt
cgaggtgaattatttattggcagccaatacttactggcatggtccgacaaactggttgaa
ttaaaaaccatctgtttttgtggccgtaaagcaagcatggtgctgcgtcttgatcaagca
ggcagaccttataacgaaggtgagcaggtggtaattggtggtaatgaacgatacgtttct
gtatgccgtaaacactataaagaggcgttacaagtcgactcattaacggctattcaggaa
aggcatcgccacgattaa

DBGET integrated database retrieval system