KEGG   Escherichia coli DH1: EcDH1_2689Help
Entry
EcDH1_2689        CDS       T01996                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
edh  Escherichia coli DH1
Pathway
edh00061  Fatty acid biosynthesis
edh01100  Metabolic pathways
edh01212  Fatty acid metabolism
Module
edh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:edh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EcDH1_2689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:edh01004]
    EcDH1_2689
Enzymes [BR:edh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     EcDH1_2689
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     EcDH1_2689
Lipid biosynthesis proteins [BR:edh01004]
 Fatty acid synthase
  Component type
   EcDH1_2689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ACX40322
LinkDB All DBs
Structure
PDB: 

Position
2864541..2865167
Genome map
AA seq 208 aa AA seqDB search
MAITLAELVYSELIGLVQRTRVSYPACFNKIRLTENMVDKRESYTKEDLLASGRGELFGA
KGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGL
DAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLA
DGEVLVDGRLIYTASDLKVGLFQDTSAF
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccattacgttggctgaactggtttattccgaactgatcggacttgttcagcgtaca
cgtgttagctatcctgcgtgcttcaataaaataaggcttacagagaacatggtagataaa
cgcgaatcctatacaaaagaagaccttcttgcctctggtcgcggtgaactgtttggcgct
aaaggcccgcaattgccagcaccgaacatgctgatgatggaccgtgtggtcaaaatgacc
gaaacgggtggtaacttcgacaaagggtatgttgaagcagaactggatatcaatccggat
ctgtggttcttcggatgccactttattggcgatccggttatgccgggatgcctgggcctg
gacgcaatgtggcagctggtagggttctacctcggctggctgggcggcgaaggtaaaggc
cgcgcgctgggcgttggcgaagtgaaattcactggtcaggtactgccgacagcgaaaaaa
gtgacctaccgtattcactttaaacgcattgttaaccgtcgtctgattatgggcctggcg
gatggcgaagtgctggttgatggtcgtctgatctataccgccagcgacctgaaagtcggt
ctgttccaggatacgtctgccttctga

DBGET integrated database retrieval system