KEGG   Escherichia coli DH1: EcDH1_2991Help
Entry
EcDH1_2991        CDS       T01996                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
edh  Escherichia coli DH1
Pathway
edh00550  Peptidoglycan biosynthesis
edh01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:edh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EcDH1_2991
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EcDH1_2991
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:edh01011]
    EcDH1_2991
Enzymes [BR:edh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EcDH1_2991
Peptidoglycan biosynthesis and degradation proteins [BR:edh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   EcDH1_2991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ACX40620
LinkDB All DBs
Structure
PDB: 

Position
3212902..3214803
Genome map
AA seq 633 aa AA seqDB search
MKLQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIVRFTDYQTRSNENRIK
LVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDALRSVVDLTDDDIAAFR
KERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKRRYYPYGSALTHVIGYVS
KINDKDVERLNNDGKLANYAATHDIGKLGIERYYEDVLHGQTGYEEVEVNNRGRVIRQLK
EVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVVVTDPRTGGVLALVSTPSYDPNLFVDG
ISSKDYSALLNDPNTPLVNRATQGVYPPASTVKPYVAVSALSAGVITRNTTLFDPGWWQL
PGSEKRYRDWKKWGHGRLNVTRSLEESADTFFYQVAYDMGIDRLSEWMGKFGYGHYTGID
LAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYWTATPIQMSKALMILINDGIVKV
PHLLMSTAEDGKQVPWVQPHEPPVGDIHSGYWELAKDGMYGVANRPNGTAHKYFASAPYK
IAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTAFAPYNNPQVAVAMILENGGAGPAV
GTLMRQILDHIMLGDNNTDLPAENPAVAAAEDH
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacagaactcttttcgcgactatacggcagagtccgcgctgtttgtgcgccgg
gcgctggtcgcctttttggggattttgctgctgaccggcgtgcttatcgccaacctgtat
aatctgcaaattgttcgctttaccgactaccagacccgctctaatgaaaaccgcattaag
ctggtgcctatcgcgcccagccgcggcattatctacgatcgtaacggtatccctctggcc
ctcaaccgcactatctaccagatagaaatgatgccggagaaagtcgataacgtgcagcaa
acgctggacgctttgcgcagcgtggtagatctgaccgatgacgatattgctgcattccga
aaagagcgcgcacgttcacaccgtttcacctctattccggtgaaaactaacctgaccgaa
gtacaagtagctcgctttgccgtcaatcagtaccgttttccgggtgtcgaagttaaaggc
tataaacgtcgttactatccttacggttcggcgttgacccacgtcatcggctatgtgtcg
aaaatcaacgataaagacgtcgaacgcctgaataatgacggcaaactggccaactatgcg
gcaacgcatgatatcggtaagctgggcattgagcgttactatgaagatgtgctgcacggt
cagaccggttatgaagaggttgaagttaacaaccgtgggcgtgttattcgccagttaaaa
gaagtaccaccgcaagccggacacgatatttacctgacgctggatctcaaactccagcaa
tatattgaaacgctgctggcgggtagccgcgcagctgtggtagtcaccgatccgcgtaca
ggtggggtgctggcgctggtttccacgcctagttatgacccaaacttgtttgttgacggt
atctccagcaaagattattccgccttgttgaacgatccgaatacaccgctggtgaaccgc
gccacacagggggtttatcctcccgcgtctacagttaaaccctatgtggcggtttcggca
ttgagcgccggggtgatcacgcgcaatacgacgctgtttgacccaggctggtggcaactg
ccaggttcggaaaaacgttatcgtgactggaaaaaatggggccacgggcgtctgaatgtc
acaagatcgctggaagaatctgcggataccttcttctatcaggtggcctacgatatgggg
atcgatcgcctctccgaatggatgggtaaattcggttatggtcattacaccggtatcgac
ctggcggaagaacgttccggcaacatgcctacccgcgaatggaaacagaaacgctttaaa
aaaccgtggtatcagggtgacaccattccggttggtatcggtcagggttactggacagcg
accccaatccagatgagtaaggcactgatgatcctgattaatgacggtatcgtgaaggtt
cctcatttgctgatgagcaccgccgaagacggcaaacaggtgccatgggtacagccgcat
gaaccgcccgtcggcgatattcattccggttactgggagctggcgaaagacggtatgtac
ggtgttgctaaccgccctaacggtacggcgcataaatactttgctagcgcaccgtacaaa
attgcggcgaaatccggtaccgctcaggtcttcggtctgaaagcgaacgaaacctataat
gcgcacaaaattgccgagcgtttacgtgaccacaaactgatgaccgcctttgcgccatac
aacaatccgcaagtggctgtcgccatgattctggagaacggtggtgcgggtccggcggtt
ggtacactgatgcgccagatcctcgaccacattatgctgggtgataacaacaccgatctg
cctgcggaaaatccagcggttgccgcagcggaggaccattaa

DBGET integrated database retrieval system