KEGG   Entamoeba dispar: EDI_278510
Entry
EDI_278510        CDS       T01083                                 

Definition
(RefSeq) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
edi  Entamoeba dispar
Pathway
edi00620  Pyruvate metabolism
edi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EDI_278510
Enzymes [BR:edi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     EDI_278510
SSDB
Other DBs
NCBI-GeneID: 5881144
NCBI-ProteinID: XP_001736163
UniProt: B0ECY8
LinkDB
AA seq 1151 aa
MFNQEKGTDYPVLNIQELEALADLKLSAMGKEYPKHDKSDAIDIVAPLVDIIAEGDQEST
APIDARLQTFLNSYFAECGEEVPKIPDNTFILDREGLGRVLSFPPHKQEFFCETMKSYKI
KQGVLHNPAKDKRTTVGVFHICQSDVPVPADKIECPKIAFLRMLKAAFYGAPADHLIIPY
TAECKEPTKSWVSLYMRPVVVPGVKGVKGFEHEKATEMHFFVPGNMVSCLDFVESVFGNA
GNPRLSKNDAALDPLGWTGHSGMAILAPHLTRMTKKECGLPHISQATERQKKERMCWEKE
DELYNDGKTFKMYCRDASGIICTIIADNYFGYCKKEVKTQISYSANLYGFAEEEHAGGAI
TRPSYDLGEACKGVQYAEGYKFSEMIEKNKQSIIVKEEGYAIDKKYPEGIIYVPEDSIFT
IEDASVKFNHNGKEESILLIPKVNYVLPNGYTIILHDTMTSRRWTLRGILPQYTLCHKPC
TVSGGGKSEISKNISDAIFEGKMFVNNKEEEFKAVQKVFDHDFSRRYADGEIKSAHILDP
NVTLGTVVKMLTPSSFFTEEHNEFVAGIPPMIVELALTIKSLYREEWKGDWQSRITVDKI
NGKEGHELKYRKMPLPSQYLRIGFERDETTWRVFQLRKDFFPAAKLQMEDDITASVIIPT
KLLKTPINTNGKKACKIVKNCELRLFQRPDDAIFRGYDKQTEYDFSIPGHFISNYQPMTR
EEAKDFTKDVVRLYQYTEPMRKCLQDFVAGKDEAKYIVSSSHTRLVQDGDKLVGSKNPRY
LQRRPDMLDPENTYMTFKAIQLFRKISDEEPLYTPVDAVLSGRRNNPPQVAKNGMKLRPL
SVFAPLHYFELPELLMECITSMTGASPSMFGAGSEGALTKGPFNSLPAVVDLNNYLLGMI
CCGYSGFVSSASYCGPHYKVAHDISLLIPEIWSRMRRYEQEPKYLIEHGYLEPCPDVTYN
GKTYSGKRLGYRITKDFTVHYFSSIFSVPNSVMPEDFLKPELQDLAIYADSYEYIEQTDK
GVAMNYIKDGTVEGACPPLKALIYIMANGEYNGMTRESKEFRDMFDAKTILNSEWYKERL
ITRQKLEINKLNKDLAYLNKTITEKPRLAETLNKQIIAVKEELQYVSSEEYLIDIDGSIG
TDPYPYKCMKH
NT seq 3456 nt   +upstreamnt  +downstreamnt
atgtttaatcaagaaaaaggtactgattatcctgttcttaatattcaagaacttgaagca
cttgcagatttaaaattatctgctatgggaaaagaatatccaaaacatgataaatctgat
gctattgatattgttgcaccattagttgatattattgctgaaggagatcaagaaagtaca
gcaccaattgatgctagacttcaaacatttcttaattcatattttgcagaatgtggagaa
gaagtaccaaaaattccagataatacttttattcttgatagagaaggacttggaagagta
ttatcatttccaccacataaacaagaattcttttgtgaaacaatgaaatcatataaaatt
aaacaaggagtacttcataatccagctaaagataaaagaactacagttggtgttttccat
atttgtcaaagtgatgttccagttccagcagataaaattgaatgtccaaaaatagcattt
ttaagaatgcttaaagcagcattttatggagcaccagctgatcatcttattattccatat
acagctgaatgtaaagaaccaacaaaatcatgggtttcactttatatgagaccagttgtt
gttccaggagtaaaaggagttaaaggatttgaacatgaaaaagctactgaaatgcatttc
tttgtaccaggaaatatggtttcatgtcttgattttgtagaatcagtttttggaaatgct
ggtaatcctagattatctaaaaatgatgcagcacttgatccacttggatggactggacat
agtggaatggctattcttgcaccacatcttactcgtatgacaaaaaaagaatgtggactt
ccacatattagtcaagcaacagaaagacaaaaaaaagaaagaatgtgttgggaaaaagaa
gatgaattatataatgatggaaaaacatttaaaatgtattgtagagatgcatcaggaatt
atttgtactattattgcagataattattttggatattgtaagaaagaagttaaaacacaa
atttcatattcagctaatttatatggatttgcagaagaagaacatgcaggaggagctata
actagaccatcatatgatcttggagaagcatgtaaaggtgttcaatatgcagaaggatat
aaatttagtgaaatgattgaaaagaataaacaatcaataattgttaaagaagaaggatat
gctatagataaaaaatatccagaaggaattatttatgttccagaagattcaatatttact
attgaagatgcatcagttaaatttaatcataatggaaaagaagaaagtattcttttaata
ccaaaagtaaattatgttttaccaaatggttatactattattttacatgatacaatgaca
tcaagaagatggacattaagaggaattcttccacaatatactctttgtcataaaccatgt
actgtttcaggaggaggaaaatcagaaatttcaaagaatatttcagatgctatatttgaa
ggaaaaatgtttgttaataataaagaagaagaatttaaagcagttcaaaaagtatttgat
catgatttttcaagaagatatgcagatggagaaattaaaagtgcacatattcttgatcca
aatgttactcttggaacagttgttaaaatgttaacaccatcatcattttttactgaagaa
cataatgaatttgttgcaggaattccaccaatgattgtagaattagctttaactattaaa
tctctttatagagaagaatggaaaggagattggcaatcaagaattactgtagataaaatt
aatggtaaagaaggacatgaattaaaatatagaaaaatgccacttccatcacaatatctt
agaattggatttgaacgtgatgaaactacatggagagttttccaattaagaaaagatttc
ttcccagctgctaaattacaaatggaagatgatattacagcatcagttattattccaact
aaattacttaaaacaccaattaatactaatggtaaaaaagcatgtaaaattgttaagaat
tgtgaattaagattattccaaagaccagatgatgcaatttttagaggatatgataaacaa
actgaatatgatttttcaattccaggacattttatttctaattatcaaccaatgactaga
gaagaagctaaagattttactaaagatgttgtaagattatatcaatatactgaaccaatg
agaaaatgtttacaagattttgttgcaggtaaagatgaagctaaatatattgtttcatca
tctcatactagattagttcaagatggagataaacttgttggatcgaaaaatccaagatat
ttacaaagaagaccagatatgttagatccagagaatacatatatgacatttaaagctatt
caattatttagaaaaattagtgatgaagaaccattatatactccagtagatgcagttctt
tcaggaagaagaaataatccaccacaagtagctaaaaatggtatgaaattaagaccatta
tcagtttttgcaccattacattattttgaattaccagaattattaatggaatgtattact
tcaatgacaggtgcatcaccatcaatgtttggagcaggatctgaaggagcattaactaaa
ggaccatttaattcacttccagcagtagttgatttaaataattatcttcttggaatgatt
tgttgtggatattcaggatttgtatcatctgcatcatattgtggaccacattataaagtt
gcacatgatatttcattattaattccagaaatttggtcaagaatgagaagatatgaacaa
gaaccaaaatatttaattgaacatggatatcttgaaccatgtcctgatgttacttataat
ggaaaaacatattcaggaaaaagacttggatatagaattacaaaagattttacagtacat
tatttctcatctattttctcagtaccaaattctgttatgccagaagatttccttaaacca
gaattacaagatttagctatttatgcagattcatatgaatatattgaacaaactgataaa
ggagttgctatgaattatattaaagatggaacagttgaaggagcatgtccaccattaaaa
gcacttatttatattatggcaaatggtgaatataatggaatgacacgtgaatcaaaagaa
tttagagatatgtttgatgctaaaactattcttaatagtgaatggtataaagaaagatta
attacaagacaaaaacttgaaattaataaattaaataaagacttagcttatttgaataag
acaattaccgaaaaaccaagattagctgaaactcttaataaacaaattattgctgttaaa
gaagaacttcaatatgtttcaagtgaagaatatcttattgatattgatggatctattgga
actgatccatatccatacaaatgcatgaaacattaa

DBGET integrated database retrieval system