KEGG   Entamoeba dispar: EDI_315760Help
Entry
EDI_315760        CDS       T01083                                 

Definition
(RefSeq) glucosidase 2 subunit alpha precursor
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
edi  Entamoeba dispar
Pathway
edi00052  Galactose metabolism
edi00500  Starch and sucrose metabolism
edi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    EDI_315760
   00500 Starch and sucrose metabolism
    EDI_315760
Enzymes [BR:edi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     EDI_315760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 5880263
NCBI-ProteinID: XP_001735323
UniProt: B0EAF9
LinkDB All DBs
AA seq 842 aa AA seqDB search
MFVFFSIIAFVIAIPNKPPTCSSRSWCNLNRFRPVSHYNADVRSYTYTNNILSFKLKPTW
SINKNIQLNIISLGDNQLYIRYTYPSIEHVRFNIPTNTAYKPLKPQDITLISSSAYVANF
KAGTTLFSVYKNASVVIDNDLCIGCTGQFLYREDVKSDYYPVGIDVEFPTKRLFGSGKNV
HQPLPLTDKSKGAFTEPYHFYASGYTTFPVNSTHPQYGNLPVFISHKGGKSTAVLYTNPT
DTFIDHELYNNKAKLLITSEDSDISFFIISKPNPQELFKSYYSLTGVSFMPPRFSLGFHN
SKWGYNSQNIAEGVDNDADKYGFMYDALWLDIEHTQRKRYFTWGSSFPHPLKLQEQLKSK
NRYLITIQDCHIASDNGYYVHDEGKNGNYFIKKGINSTDDYVGECWPLKSNWVDFLSEEA
RNWWAGLYSFDKYKDTTEIVYAWNDMNEPTEFDIQDLLVKKEAVHNGGILHKNVHNLYGM
LQQMSTQKGLLERTNNKYRPFVLTRSYYIGSQKYGAMWTGDSDATWEYLSSQVSQLVNIN
MLGFLCGGDVGGFAHNPSTELLIRWYQAGALQPFFRQHSSQTASRREPWLFEQNVADRLK
RAVNLRYQMLPYWYSLWYYHRIDYNPVIRAMYYSFPESDNLFDNENQYMIGDALLASPVI
QEGETNHQIQIPKGKWYDYFNNSNVYNGPMNLVIPVTLDSIPLFGRGGYIITERMVTEGR
KSGSESEKNDYLRVVIYDSMGHAEGKFYTDDGISVDNSDNYVAVTMTMNNYSFDYTVQGD
YLYGEFINEFVLVTEKKFTNAFIIRGSEETEIKFTQENGRLVISNFNNHFSSQWSHWSLR
FK
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttttcttctctattattgcttttgttattgcaatacccaataaacctcctaca
tgttctagtaggtcatggtgtaatttaaatagatttagacctgtttcccattataatgct
gatgtacgttcatatacttatactaataatattttatcatttaagttaaagccaacttgg
agcataaataagaatattcaattaaatattatttcattaggtgataatcagttatatatt
agatatacttatccatctattgaacatgttagatttaatattccaacaaatactgcttat
aaacctcttaaaccacaagacattacactaatatcttctagtgcttatgtagctaatttt
aaagcaggaacaactttattttcagtttataaaaatgcatcagttgtaattgataatgat
ttatgtattggatgtactggacaattcctttatagagaagatgttaaaagtgattattat
ccagttggaattgatgtagaatttccaactaaacgattatttggatctggtaaaaatgta
catcaaccacttcctttaactgataagtctaaaggagcttttactgagccatatcatttt
tatgcttcaggatatactacattccctgttaattctactcatccacaatatggtaattta
cctgtctttatatctcataaaggaggtaaatcaacagcagtattatatactaatccaaca
gacacatttattgaccatgaactttataacaacaaggctaaattacttattacttcagaa
gacagcgatatttctttctttattatttcaaaaccaaatccacaagagttatttaagagt
tattattcattaactggtgtttcttttatgccaccaagattttctcttggattccataat
agtaaatggggctataattcacaaaacattgctgaaggtgttgataatgatgctgataaa
tatggttttatgtatgatgctttatggcttgatattgagcatacacaacgtaaacgatac
ttcacttggggatcttctttccctcatcctttaaaattacaagaacaattaaaatcaaag
aatagatatcttatcactattcaagattgtcatattgcatcagacaatggttactatgtc
catgatgaaggtaaaaacggaaattatttcattaagaaaggtattaatagtactgatgat
tatgtaggtgaatgttggcctttaaaatctaattgggtagatttcttatcagaagaagct
agaaattggtgggctggattatattcatttgataaatacaaagatacaactgaaatagtt
tatgcatggaatgatatgaatgaaccaactgaatttgatatacaagatttattagttaag
aaagaagctgttcataatggaggtattcttcacaaaaatgtacacaacctttatggtatg
ttacaacaaatgtctactcaaaaagggttattagagagaacaaataataagtatagacca
ttcgtcttaacaaggtcatattatattggttcacaaaagtatggtgctatgtggactgga
gactctgatgctacttgggagtatttatctagtcaagttagtcaattagttaatattaat
atgcttggattcctatgtggaggagacgttggaggatttgctcataatccatccactgaa
ttattaattcgttggtatcaagctggtgcattacaaccattcttcagacaacattctagt
caaacagctagtagaagagagccatggttatttgaacaaaatgttgctgatagattaaaa
cgtgcagttaatttaagatatcaaatgttaccatattggtattccttgtggtattatcat
agaattgattataatccagtaatcagagcaatgtattattcattcccagaatcagataac
ttatttgataatgagaatcaatatatgattggtgacgctttattagcatcaccagtaatt
caagaaggagaaacaaatcatcaaatacaaattcctaaaggtaaatggtatgattacttt
aataacagtaacgtatacaatggaccaatgaatttagtaattccagttactttagattct
attccattatttggaagaggaggttatatcattactgagagaatggttactgagggaaga
aaatctggttcagagtctgaaaagaatgactatcttcgagttgttatttatgatagtatg
ggacatgctgaaggtaaattctatactgatgacggtattagtgttgacaactctgataat
tatgttgctgttactatgaccatgaacaattactcatttgattacactgttcaaggagat
tacttgtacggtgaattcattaacgaatttgttttagttactgagaaaaagtttaccaat
gcatttatcataagaggtagtgaagaaactgaaattaaatttacacaagaaaatggcaga
ttagtcattagtaactttaacaatcacttcagttctcaatggtctcattggtctcttcgt
ttcaaataa

DBGET integrated database retrieval system