KEGG   Escherichia coli DH1: ECDH1ME8569_2110Help
Entry
ECDH1ME8569_2110  CDS       T02102                                 

Gene name
yeiR
Definition
(GenBank) predicted enzyme
Organism
edj  Escherichia coli DH1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cobW CobW_C T2SSE Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: BAJ43966
LinkDB All DBs
Position
2252823..2253809
Genome map
AA seq 328 aa AA seqDB search
MTRTNLITGFLGSGKTTSILHLLAHKDPNEKWAVLVNEFGEVGIDGALLADSGALLKEIP
GGCMCCVNGLPMQVGLNTLLRQGKPDRLLIEPTGLGHPKQILDLLTAPVYEPWIDLRATL
CILDPRLLLDEKSASNENFRDQLAAADIIVANKSDRTTPESEQALQRWWQQNGGDRQLIH
SEHGKVDGHLLDLPRRNLAELPASAAHSHQHVVKKGLAALSLPEHQRWRRSLNSGQGYQA
CGWIFDADTVFDTIGILEWARLAPVERVKGVLRIPEGLVRINRQGDDLHIETQNVAPPDS
RIELISSSEADWNALQSALLKLRLATTA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaggaccaacctcatcaccggttttctcggcagcgggaaaaccacgtcgattctt
catctgttagcccataaagatcccaacgaaaaatgggcggtactggttaatgaatttggg
gaagtcggaattgatggtgctttgctcgccgatagcggcgcattgctgaaagagatcccc
ggcggctgcatgtgctgcgttaatggtttacccatgcaggtagggttgaataccttactg
cgtcagggaaaaccagaccgcttgttgatagagccgaccgggctgggccatccgaaacag
atcctcgatctgttaaccgcaccagtctatgaaccgtggatagatctgcgcgccaccttg
tgcattctcgatccgcgcttgctgctggacgaaaaaagcgccagcaatgaaaacttccgt
gaccagctggctgccgcagacatcattgtcgccaataaatccgaccgtacgacgcccgaa
agtgagcaagcgctacagcgttggtggcagcaaaatggtggcgatcgacaattaattcac
agtgagcatgggaaagttgacggtcatcttctggatttgccgcgtcgcaatttagccgag
ttgcccgccagcgccgcgcattctcatcagcatgtcgtgaaaaaagggttagcagcgtta
agcctgccagagcatcaacgctggcgtcgcagtctgaacagcgggcaaggatatcaggcc
tgcggctggatattcgacgctgatacggtattcgacaccattggcattctggaatgggcg
cgacttgcaccggtggaacgcgtcaaaggcgtgctgcgtattcccgaagggctggtgcga
atcaaccgtcagggcgatgacctgcacattgaaacgcaaaacgttgcgccaccggacagc
cgtattgagctgatttccagcagcgaagctgactggaatgccttgcagagcgcgctgttg
aagcttcgtttagcgactaccgcgtaa

DBGET integrated database retrieval system