KEGG   Escherichia coli DH1: ECDH1ME8569_3757Help
Entry
ECDH1ME8569_3757  CDS       T02102                                 

Gene name
yihY
Definition
(GenBank) tRNA-processing ribonuclease BN
  KO
K07058  membrane protein
Organism
edj  Escherichia coli DH1
Brite
KEGG Orthology (KO) [BR:edj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    ECDH1ME8569_3757 (yihY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: BAJ45613
LinkDB All DBs
Position
4055251..4056123
Genome map
AA seq 290 aa AA seqDB search
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA
FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI
DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV
LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL
IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaaccattcaggacaaagccaggcaccgtacccgtccactatgggcctggcta
aaactactctggcaacgcattgatgaggacaacatgacaaccctggcaggtaaccttgcc
tatgtgtcgttgctctcattagtgccgctggttgccgttgtttttgcgcttttcgccgct
tttcccatgttttccgacgtcagcattcagttacgtcactttatttttgccaactttctg
cctgctactggcgatgttattcagcggtatatcgaacaatttgttgccaattccaacaag
atgaccgccgttggggcgtgcgggctgatcgtcaccgcgttattgttgatgtactccatc
gatagcgcgttgaataccatctggcgcagtaaacgagcgcgaccaaaaatttactcgttc
gccgtgtactggatgattttaacgctggggccgctgctggcaggggccagtctggcgatc
agttcctatttgctctccctgcgctgggcgagcgatctcaatactgtcatcgacaacgtg
ctgcgtatttttccgttgctgttgtcgtggatctccttctggttgctgtacagcattgtt
cctaccatccgcgtacctaaccgcgacgcgattgtcggcgcgtttgtcgccgcactcctg
ttcgaagcaggaaagaaaggtttcgcgctttatatcaccatgttcccgtcatatcagctc
atttatggtgtgctggcggtgatccccattctctttgtttgggtctactggacatggtgt
atcgtcttgcttggcgcggaaattactgtcactctcggggaataccgcaaactaaaacaa
gcagctgaacaagaagaagacgacgaaccatga

DBGET integrated database retrieval system