KEGG   Edwardsiella sp. LADL05-105: AAZ33_01120Help
Entry
AAZ33_01120       CDS       T04005                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
edl  Edwardsiella sp. LADL05-105
Brite
Enzymes [BR:edl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AAZ33_01120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AKR76528
LinkDB All DBs
Position
258917..259444
Genome map
AA seq 175 aa AA seqDB search
MKKMKILVLATALMSGAAYSASESITLYEAGPQGAGPTIGEVTVSETPYGLLFTPSLRGL
PQGIHGFHVHENASCLPGVKEGKPVPALMAGGHWDPEKRGKHMGPYSDAGHLGDLPGLVV
NADGTANYAVLAPRLKSLAQLKGHALMVHVGGDNYDDHPHALGGGGARMACGVIQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgaaaatattggtactggccaccgcgttgatgagcggggctgcctacagc
gcctctgagtcgataacgctgtatgaagcggggccgcagggggcgggaccgacgatcggt
gaggtgacggtcagcgaaacgccctatggcctgctgtttacgcccagcctgcgcggtctc
ccgcaggggatccacggttttcatgtccatgaaaacgccagctgcctgccgggtgtcaaa
gagggtaaaccggtgccggccctgatggccggtggtcactgggatcccgagaagcgcggt
aagcatatggggccctacagcgatgccgggcatctgggcgatctgccgggactggtggtc
aatgcggacggtacggcgaactatgccgtgctggcaccgcgtctgaaatcgctcgcccag
ctgaaggggcatgcgctgatggtgcacgtcggcggcgataactatgacgatcatccgcac
gcgctgggcggcggcggtgcgcgtatggcctgcggcgttattcagtaa

DBGET integrated database retrieval system