KEGG   Edwardsiella sp. LADL05-105: AAZ33_03540Help
Entry
AAZ33_03540       CDS       T04005                                 

Definition
(GenBank) hypothetical protein
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
edl  Edwardsiella sp. LADL05-105
Pathway
edl00061  Fatty acid biosynthesis
edl00780  Biotin metabolism
edl01100  Metabolic pathways
edl01212  Fatty acid metabolism
Module
edl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:edl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AAZ33_03540
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AAZ33_03540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:edl01004]
    AAZ33_03540
Enzymes [BR:edl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AAZ33_03540
Lipid biosynthesis proteins [BR:edl01004]
 Fatty acid synthase
  Component type
   AAZ33_03540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: AKR76929
LinkDB All DBs
Position
791722..792177
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLNISEILELLPHRFPFLLVDRVLDYQEGKFLRAVKNVSFNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDDARFKRPVHPGDQMILEVEFLKE
RRGVARFNGVAKVDGKIVCEASMMCARNREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctcaatatttcagagattttagagcttctgccgcaccgt
tttccgttcctgctggtggatcgtgtgctggattatcaagagggcaaattcctgcgtgca
gtgaagaatgtctccttcaacgagccatttttccagggacacttcccgggcaagccgatt
ttccccggggtgctgatcctcgaagccatggcgcaggccaccggtattctggcattcaag
agcgtgggcaaactggagccgggcgaactgtactacttcgccggtatcgatgacgcccgc
tttaagcgtccggttcatccgggtgaccagatgatcctggaagtggagtttctgaaagag
cgccgcggcgtggctcgctttaacggtgttgccaaggttgacggcaagatcgtgtgcgag
gcgtccatgatgtgcgcccgtaaccgtgaggcctga

DBGET integrated database retrieval system