KEGG   Edwardsiella sp. LADL05-105: AAZ33_08755
Entry
AAZ33_08755       CDS       T04005                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
edl  Edwardsiella sp. LADL05-105
Pathway
edl00480  Glutathione metabolism
edl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AAZ33_08755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:edl02000]
    AAZ33_08755
Enzymes [BR:edl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AAZ33_08755
Transporters [BR:edl02000]
 Other transporters
  Pores ion channels [TC:1]
   AAZ33_08755
SSDB
Motif
Pfam: GST_C GST_N GST_N_2 GST_N_3 GST_C_3 GST_C_2 GST_N_5 GST_C_6
Other DBs
NCBI-ProteinID: AKR77727
LinkDB
Position
complement(1945184..1945789)
AA seq 201 aa
MKLFYKSGACSLSPHIVLREAGLDFTIESVDLASKRTEHGSDYLRINPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRALIPPQETLARYHAIEWLNYIATEIHKGFSPLFNPRQPQE
SKAIARAALEKQFHYLNGVLSERPYLLGPSFSVADAYLFTTLCWAKAMHFDLAVWPALAD
YMARIAARPAVDATLSAEGLK
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaattgttctataaatccggggcctgctctctttcaccgcatatcgtactgcgtgag
gccggtctggacttcaccatcgaaagtgtggatctggccagcaaacgtaccgagcacggc
agcgactatctgcgtattaatcccaagggacaggtgccggcgctgctgctggatgacggc
agtctgctgaccgaaggggtggccatcgtgcagtacctggccgatcgggtgccagaccgc
gcgctgatcccgccgcaggagacgctggcgcgctatcacgcgatcgaatggctcaactat
attgccaccgagatccataagggattcagcccgctgttcaatccgcgccagccgcaggag
agcaaggcgatagcgcgcgcggcgctggagaagcagttccactacctcaacggcgtactc
agcgagcgtccctacctgctggggcccagcttcagcgtcgccgacgcctatctgttcacc
acgctgtgctgggccaaggcgatgcacttcgatctggccgtctggccggcgctggccgac
tatatggcgcgtatcgccgcgcggccggcggtcgatgctacgctcagcgccgaggggttg
aagtag

DBGET integrated database retrieval system