KEGG   Edwardsiella sp. LADL05-105: AAZ33_14000Help
Entry
AAZ33_14000       CDS       T04005                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
edl  Edwardsiella sp. LADL05-105
Pathway
edl00550  Peptidoglycan biosynthesis
edl01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:edl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AAZ33_14000
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AAZ33_14000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:edl01011]
    AAZ33_14000
Enzymes [BR:edl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AAZ33_14000
Peptidoglycan biosynthesis and degradation proteins [BR:edl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AAZ33_14000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AKR78560
LinkDB All DBs
Position
3119968..3121863
Genome map
AA seq 631 aa AA seqDB search
MKLDRNPFRDYSAESALFIRRALFAFVGVLLLTGVLLANLYHLQILRFEDYRTRSNENRI
KLVPIAPSRGMIYDRNGTPLAFNRTIYQLEVIPEKVDGMTAQLDALRPIVDLTDEDLDSF
QKERKRSRRFTSIPLKTALSEVQVARFAVNQFRFPGFEVKGYQRRYYPYGSALTHVIGYV
SKINDKDVERLDKEGKLANYAATHDIGKLGIERYYEDVLHGKTGYEEVEVNNRGRVIRQL
HEQPPQAGKDIYLTLDLNLQRYIEQLLVGSRAAVVVSDPRSGGILALVSTPSYDPNLFVD
GISGKDYRGLLNDPNRPLINRATQGVYPPASTVKPYVAVSALSAGVISRNTTLFDPGWWQ
LPGSEKRFRDWKKWGHGRLSVTKALEESADTFFYQVAYDMGIDRLSEWLSKFGYGQYTGI
DLSEERSGLMPTREWKLKRYKKPWYQGDTIPVGIGQGYWTATPIQMAKALNTLINDGNVK
VPHLLMSTRINGQLVPFRQQESQQIGDIHSGFWEIAKDGMFGVANRPNGTGYKYFGSAPY
KIAAKSGTAQVFGYETYNAHTIAEHLRDHKLMTAFAPYDNPQVSVAIILENGGAGPAVGT
IMRQILDHIMLGDNNTQLPNAAPTPPGVEGD
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaaactagatcgtaacccctttcgtgactattcggcagagtccgccctgttcatccgt
cgtgcgctgttcgccttcgtcggcgtactgctgctgaccggcgtactgctcgccaatctg
taccacctgcaaattctgcgttttgaagactacaggacgcgctctaacgaaaaccgcatc
aagctggtgcccatcgcccccagccgcggcatgatctacgatcgcaacggcaccccgctg
gcgtttaaccgcaccatctaccagttggaggtgatccccgaaaaggtcgacggaatgaca
gcgcagctcgatgcgctacgcccgatcgtcgatctgaccgacgaggatctcgacagcttc
cagaaggagcgcaagcgctcgcggcgcttcacctcgattccgctgaagaccgccctcagc
gaggtgcaggtggcccgctttgccgtcaaccagttccgcttccccggctttgaggtcaag
ggctaccagcgtcgctactacccctacggctccgccctgacccacgtcatcggctatgtc
tccaagatcaacgacaaagacgtcgagcgtctggataaagaggggaagctggccaactac
gccgccacccacgacatcggcaagctgggcatcgaacgttactatgaggatgtgctgcac
ggcaaaaccggctatgaagaggtggaggtcaacaaccgcgggcgggtgatccgccagctg
cacgagcagccgccccaggcgggtaaagatatctacctgacgctggatctcaacctgcag
cgctatatcgagcagctgctggtcggcagccgcgccgccgtggtggtcagcgatccgcgc
agcggcgggatcctggcgctggtctccacccccagctacgaccctaacctgttcgtcgac
ggcatctccggcaaggattaccgcggcctgctcaacgaccccaaccggccgctgatcaac
cgcgccacccagggggtctatcctcccgcttcgacggtcaaaccctacgtcgcggtctcg
gcgctcagcgccggcgtgatctcccgcaataccaccctcttcgaccccggctggtggcag
ctgcccggatcagagaagcgctttcgcgactggaagaagtggggccatgggcggctgagc
gtcaccaaggcgttggaggagtcggcagacaccttcttctaccaggtggcctatgacatg
gggatcgaccgcctgagcgagtggctgtccaagttcggctatggccagtataccggtatc
gatctgtccgaggagcgctccggcctgatgccgacccgcgaatggaagctcaagcgctac
aagaaaccctggtatcagggtgacactatcccggtcggcatcggccagggctactggacc
gcgacgccgatccagatggccaaggcgctcaacaccctgatcaacgacggcaacgtcaag
gtgccacacctgctgatgagcacccgcatcaacggtcagctggtgccgttccgccagcag
gagagccagcagataggcgatattcactccggcttctgggagatcgccaaagatggcatg
ttcggcgtggccaaccggcccaacggcaccggctacaagtattttggcagcgccccgtat
aaaatcgccgccaagtccggtaccgcccaggtcttcggctacgagacctacaacgcgcat
accatcgccgagcatctgcgcgaccataagctgatgaccgccttcgccccctatgacaac
ccgcaggtgtcggtggccatcattctggagaacggcggcgccggcccggcggtgggcacc
atcatgcgccagatcctggatcacatcatgctgggcgacaacaatacccagcttcccaat
gcagcccccacgccacccggcgtggagggcgactga

DBGET integrated database retrieval system