KEGG   Edwardsiella sp. LADL05-105: AAZ33_14015Help
Entry
AAZ33_14015       CDS       T04005                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
edl  Edwardsiella sp. LADL05-105
Pathway
edl00550  Peptidoglycan biosynthesis
edl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AAZ33_14015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:edl01002]
    AAZ33_14015
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:edl01011]
    AAZ33_14015
Enzymes [BR:edl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AAZ33_14015
Peptidases [BR:edl01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AAZ33_14015
Peptidoglycan biosynthesis and degradation proteins [BR:edl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AAZ33_14015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AKR78562
LinkDB All DBs
Position
3124058..3125269
Genome map
AA seq 403 aa AA seqDB search
MKRKVASQTLKYAVAGGLLAVALTGAARADDVNLKTMIPGVPQIDAEAYILIDYNSGKVL
AEHNADERRNPASLTKMMTSYVIGQAMRAGKFGENDVVTVGKDAWATGNPVFQGSSLMFL
KPGDQVSVGNLIRGINLVSGNDACVAMADYVAGSQDAFVGLMNSYVKALGLQNTHFETVH
GLDAPGQFSSARDMALIGQALIRDVPHEYAIYKEKEFTYNNIRQTNRNGLLWDTSMNVDG
IKTGHTASAGYNLVASATEGNMRLISAVMGGRTFKGRETESKKLLTWGFRFFETVSPLKA
GREFASEPVWFGDTDRAQLGVDKDVYLTIPRGRMKDLKASYVLNSNELDAPLAKDQVVGT
INFQLDGKTIEQRPLVVLNEVKEGGFFSRMIDHIKLLFHRWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaaagttgcttcccaaacactgaaatacgctgtcgccggcggtctgctggcc
gtggcgctcaccggtgcggcccgcgccgacgacgttaacctgaagaccatgatcccgggc
gtgccgcaaatcgatgccgaagcctatattctgatcgactacaactccggcaaggtgctg
gcggagcacaacgccgacgagcgacgtaatccggcctcgctgaccaagatgatgaccagc
tacgtcatcggacaggcgatgcgcgcgggcaagttcggtgagaatgacgtcgtcaccgtc
ggcaaagacgcctgggcgacgggcaacccggtgttccagggctcctcgctgatgttcctc
aagccgggcgatcaggtctccgtggggaacctgatccgcgggatcaacctggtctccggt
aacgatgcctgcgtcgccatggccgactatgtcgccggcagccaggacgccttcgtcggc
ctgatgaacagctacgtgaaggcgctgggtctgcagaacacccactttgagacggtacac
ggcctggacgcgccggggcagttcagctccgcccgcgacatggcgctgatcggccaggcg
ctgatccgcgacgtcccccatgagtacgccatctacaaagagaaagagttcacctataac
aacatccgccagaccaaccgtaacggtctgctgtgggataccagcatgaacgtggacggc
atcaaaaccggccataccgcctctgcgggctataacctggtggcctcggcgaccgagggc
aacatgcgcctgatctccgccgtcatgggcggccgcacctttaagggacgcgagaccgag
agcaagaagctgctgacctggggcttccgcttctttgaaaccgtctcgccgctgaaggcc
gggcgtgagttcgcctctgagccggtctggttcggtgacaccgaccgcgcccagctggga
gtcgataaagacgtctacctgaccatcccgcgcggacggatgaaagatctcaaggccagc
tatgtgctgaacagtaacgagctggatgccccgctggccaaggatcaggtggtcggtacg
atcaacttccagctggacggcaagaccatcgagcagcgcccgctggtggtgctgaacgaa
gtgaaagagggtggtttcttcagccggatgatcgatcatatcaagctgctgtttcatcgc
tggtttggttaa

DBGET integrated database retrieval system