KEGG   Edwardsiella sp. LADL05-105: AAZ33_15275Help
Entry
AAZ33_15275       CDS       T04005                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
edl  Edwardsiella sp. LADL05-105
Pathway
edl00250  Alanine, aspartate and glutamate metabolism
edl00410  beta-Alanine metabolism
edl00430  Taurine and hypotaurine metabolism
edl00650  Butanoate metabolism
edl01100  Metabolic pathways
edl01110  Biosynthesis of secondary metabolites
edl01120  Microbial metabolism in diverse environments
edl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:edl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AAZ33_15275
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AAZ33_15275
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AAZ33_15275
   00430 Taurine and hypotaurine metabolism
    AAZ33_15275
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AAZ33_15275
Enzymes [BR:edl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AAZ33_15275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC PRTase_3
Motif
Other DBs
NCBI-ProteinID: AKR78757
LinkDB All DBs
Position
complement(3414824..3416218)
Genome map
AA seq 464 aa AA seqDB search
MKKGTDTRGGYLDSRFGSETIRTAAEAHHFPQGEMREDIAFQIINDELFLDGNARQNLAT
FCQTWDDDYVHRLMDISINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPRPADGQAIGTN
TIGSSEACMLGGMAMKWRWRAKRLAQGKPADKPNMVCGPVQVCWHKFARYWDVELREIPM
APGKLFMDPERMIAACDENTIGVVPTFGVTYTGNYEMPDVLHKALDDLQARTGLDIDMHV
DAASGGFLAPFCAPDIVWDFRLPRVKSISSSGHKFGLAPLGCGWVVWRDAASLPEDLIFK
VDYLGGQVGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVHTASYQVAQFLAAEIAKLGP
YEFICSGDPQQGIPAVCFRIPAGKELGYSLYDLSERLRLRGWQVPAFALNGEMSDVVVMR
IMCRRGFEMDFAQLLMADFRAALAYLKAYPAVAHVAHQNSFKHS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtactgacacccgtgggggatatttggattcccgctttggttcagagact
attcgcacggcggcggaggctcaccattttcctcagggagaaatgcgcgaagacattgct
ttccagattattaacgatgagctgtttttagatggcaatgcccggcaaaacctggcgacg
ttttgccagacctgggatgacgactatgtacaccgcctgatggatatttcgatcaataaa
aactggatcgataaagaggagtatccacagtcggcagcgatcgatctgcgctgcgtcaac
atggtggccgatctgtggcatgcgccgcgtccggcggacgggcaggccatcggtaccaat
accatcggctcctccgaggcctgcatgctgggcggcatggcgatgaagtggcgctggcgc
gccaagcgtctggcgcagggaaaaccagcggataaacccaatatggtgtgcgggccggta
caggtctgctggcataagtttgcccgctactgggatgtcgaactgcgcgagatcccgatg
gcgcccggcaagctgtttatggatccggagcggatgatcgccgcctgcgatgagaacacc
atcggcgtcgtgccgaccttcggcgtaacctacaccggtaactatgagatgcctgatgtg
ctgcacaaggcgttggacgatctgcaggcgcgtaccgggctggatatcgacatgcacgtc
gacgctgccagcggcggcttcctggcgccgttctgcgccccggatatcgtctgggacttc
cgcctgccgcgggtcaaatccatcagctcatccgggcataagttcggcttggcgccgctc
ggctgcggctgggtggtgtggcgcgacgccgcctccctgccggaggatctgatctttaag
gtggactatctgggtggacaggtcggtacctttgccattaacttttcccgtcccgcgggc
caggtgatcgcgcagtactatgagttcctgcgtctgggacgcgagggctacaccaaggtg
cataccgccagctatcaggtggcgcagttcctggcggcggagatcgctaagctggggccc
tatgagtttatctgtagcggtgatccgcagcagggcatcccggcggtgtgcttccgcatt
ccggccggcaaggagttgggctatagcctgtacgatctctccgagcgcctgcgcctgcgc
ggctggcaggttccggcctttgccctgaacggcgaaatgtccgatgtggtggtgatgcgc
atcatgtgccgccgcggctttgagatggacttcgctcagctgctgatggcggacttccgc
gcggcgctggcctatctcaaggcctatccggcagtggcccatgtggcgcatcagaacagc
ttcaagcattcctga

DBGET integrated database retrieval system