KEGG   Enterococcus durans: LIU_05590Help
Entry
LIU_05590         CDS       T04048                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
edu  Enterococcus durans
Brite
Enzymes [BR:edu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LIU_05590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HsbA DUF2788
Motif
Other DBs
NCBI-ProteinID: AKZ47936
UniProt: A0A377L1M6
LinkDB All DBs
Position
1181278..1181886
Genome map
AA seq 202 aa AA seqDB search
MTYTLPDLPYAFDALEPYIDEETMHLHHDKHHNTYVTNLNAAIEKYPELGEKSVEELLSD
MDAIPTDIKTAVQNNGGGHANHSFFWKIMAPNAGGEPTGEIKEAIDEAFGDFATFKEEFK
KAAAGRFGSGWAWLVLEDGKLAITSTANQDSPLMTGQTPILGLDVWEHAYYLKYKNVRPD
YIAAFWNVVNWDEVNKQFAAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacattaccagatctaccttatgcatttgatgcactggaaccatatatcgat
gaagaaacgatgcacttgcatcatgacaaacaccataatacttatgttacaaatttaaac
gcagctattgaaaagtatccagaattaggcgaaaaatcagtggaagaattgctttctgat
atggacgcgattcctactgatattaagacagcggtacaaaacaatggtggtggacatgca
aaccattcatttttctggaaaatcatggcacctaatgcaggtggcgaaccaacaggggaa
atcaaagaagcgattgatgaagcttttggtgatttcgcaacatttaaagaagagttcaag
aaagcggctgccggacgctttggatcaggttgggcatggttagtattggaagatggtaaa
ttggcaatcacttctacagcaaaccaagattctccattgatgacaggccaaacacctatc
ttaggattagatgtgtgggaacatgcatattacttgaaatataaaaatgtacgccctgac
tatattgctgctttttggaatgttgtcaactgggatgaagtaaacaaacaatttgcagct
gcaaaataa

DBGET integrated database retrieval system