KEGG   Enterococcus durans: LIU_07465Help
Entry
LIU_07465         CDS       T04048                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
edu  Enterococcus durans
Pathway
edu00061  Fatty acid biosynthesis
edu00780  Biotin metabolism
edu01100  Metabolic pathways
edu01130  Biosynthesis of antibiotics
edu01212  Fatty acid metabolism
Module
edu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:edu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LIU_07465
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LIU_07465
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LIU_07465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:edu01004]
    LIU_07465
Enzymes [BR:edu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     LIU_07465
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     LIU_07465
Lipid biosynthesis proteins [BR:edu01004]
 Fatty acid synthase
  Component type
   LIU_07465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR DUF5334
Motif
Other DBs
NCBI-ProteinID: AKZ48250
UniProt: A0A2A7SMB7
LinkDB All DBs
Position
complement(1568747..1569502)
Genome map
AA seq 251 aa AA seqDB search
MSFLEGKKIVIMGVANKRSIAWGCAEAMMKQGAEIIYTYQNERMKKSLVKLVGEDAFTVE
CDVASDESIETAMNAIGEYAGEIHGLVHAIAYANKEELSGNVSDISRDGYQLAQDISSYS
LIAVSKYAQKYLAPNSGIVSMSYLGSERAIPNYNMMGIAKASLEAAIRYLAAEFSPKGIR
VNGISAGAIKTLAVTGVKDYQKLIQLSESRTPDQQGVTIEEVGNACAFLISPLSSGMIGD
IIYVDKGVHLS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttttagaaggaaagaaaatcgtcatcatgggagttgccaataagcgtagtatt
gcttggggctgtgctgaagcgatgatgaaacaaggtgcggaaatcatctatacttatcaa
aatgaacgaatgaaaaaatcattggttaagttagtcggtgaagacgcatttacggttgaa
tgtgatgtggcaagtgatgaaagtatcgaaacagcgatgaacgcgatcggtgaatacgct
ggagagatccatggattggtgcatgccatcgcctatgccaataaagaagaactatcaggt
aacgtatctgatatttccagagatggttatcaattagcgcaagatatcagcagttattct
ttgattgctgtttcaaaatatgcgcaaaagtatcttgcaccaaacagtggaatcgtcagc
atgtcttatctaggatcagaacgtgcgataccaaattacaatatgatggggatcgccaaa
gcatcactagaagccgctatccgttacttggcagcagaattctcacctaaagggattcgt
gtcaacggcatttctgcgggagcaatcaaaacattagccgttactggtgtgaaagattac
caaaaactgatccagttatctgaatcacgtacacctgaccaacaaggtgttacgatcgaa
gaagttgggaacgcctgcgccttcttgatcagtcccctttcaagcgggatgatcggtgat
atcatctatgttgataaaggtgttcatttatcttaa

DBGET integrated database retrieval system