KEGG   Enterococcus durans: LIU_13355Help
Entry
LIU_13355         CDS       T04048                                 

Definition
(GenBank) anthranilate synthase subunit II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
edu  Enterococcus durans
Pathway
edu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
edu01100  Metabolic pathways
edu01110  Biosynthesis of secondary metabolites
edu01130  Biosynthesis of antibiotics
edu01230  Biosynthesis of amino acids
edu02024  Quorum sensing
Module
edu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:edu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LIU_13355
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    LIU_13355
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LIU_13355
Enzymes [BR:edu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     LIU_13355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AKZ49258
UniProt: A0A377L8E4
LinkDB All DBs
Position
complement(2836088..2836630)
Genome map
AA seq 180 aa AA seqDB search
MILLVDNYDSFTYNLVHLLPDTEIIVLRNDDQRLLEVARKADGIILSPGPGKPAEAGDLE
KLIQLFYQTKPILGICLGHQAIGEVFGAKIVSAPTIMHGKQSVINNKKIMRYHSLIVSKE
HFPEELCITAEVDGYIMAMKHREYPIYGLQFHPESIGTENGEDYLTEFLQKAGITDATTI
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgattttattagtcgataattatgattcttttacgtataacttggttcatttacttcca
gatacggagatcatcgtcttacgaaatgacgaccaacgactgttggaagtcgctcgcaaa
gcagatggcatcattctttcaccgggacctggaaaaccagcagaagcaggtgatctagaa
aaattgatccaattgttctatcaaacgaaaccaattttaggaatatgtctggggcatcaa
gccattggtgaagtatttggtgcaaagatcgtatctgcacccacaatcatgcatggaaag
caatcggtgatcaacaacaagaaaatcatgcgttatcattcattgattgtgtcaaaagaa
cattttccggaagaactttgtatcaccgcagaagtggatggctacatcatggcaatgaaa
catcgggaatacccgatatatggactgcaattccatccagaatctatcggtactgaaaat
ggggaagactatttaacggaatttttacagaaagcagggattactgatgcaacaactatt
tga

DBGET integrated database retrieval system