KEGG   Edwardsiella sp. EA181011: QY76_01625Help
Entry
QY76_01625        CDS       T03991                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
edw  Edwardsiella sp. EA181011
Brite
Enzymes [BR:edw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     QY76_01625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AKM46204
LinkDB All DBs
Position
complement(345720..346247)
Genome map
AA seq 175 aa AA seqDB search
MKKMKILVLATALMSGAAYSASESITLYEAGPQGAGPTIGEVTVSETPYGLLFTPSLRGL
PQGIHGFHVHENASCLPGVKEGKPVPALMAGGHWDPEKRGKHMGPYSDAGHLGDLPGLVV
NADGTANYAVLAPRLKSLAQLKGHALMVHVGGDNYDDHPHALGGGGARMACGVIQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgaaaatattggtactggccaccgcgttgatgagcggggctgcctacagc
gcctctgagtcgataacgctgtatgaagcggggccgcagggggcgggaccgacgatcggt
gaggtgacggtcagcgaaacgccctatggcctgctgtttacgcccagcctgcgcggtctc
ccgcaggggatccacggttttcatgtccatgaaaacgccagctgcctgccgggtgtcaaa
gagggtaaaccggtgccggccctgatggccggtggtcactgggatcccgagaagcgcggt
aagcatatggggccctacagcgatgccgggcatctgggcgatctgccgggactggtggtc
aatgcggacggtacggcgaactatgccgtgctggcaccgcgtctgaaatcgctcgcccag
ctgaaggggcatgcgctgatggtgcacgtcggcggcgataactatgacgatcatccgcac
gcgctgggcggcggcggtgcgcgtatggcctgcggcgttattcagtaa

DBGET integrated database retrieval system