KEGG   Edwardsiella sp. EA181011: QY76_03785Help
Entry
QY76_03785        CDS       T03991                                 

Definition
(GenBank) formate dehydrogenase
  KO
K08349  formate dehydrogenase-N, beta subunit
Organism
edw  Edwardsiella sp. EA181011
Pathway
edw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:edw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    QY76_03785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_21 Fer4_6 Fer4_2 Fer4 Fer4_17 Fer4_4 Fer4_16 Fer4_3 Fer4_20
Motif
Other DBs
NCBI-ProteinID: AKM46571
LinkDB All DBs
Position
complement(843854..844807)
Genome map
AA seq 317 aa AA seqDB search
MSLQSQDIIKRSATNSLTPPPNGRNHQEEVAKLIDVTTCVGCKACQVGCSEWNDIRDEVG
HCVGVYDNPADLSAKSWTVMRFSEVEENGKLEWLIRKDGCMHCADPGCLKACPSAGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFNVPRMNPEDKRVYKCTLCVDRVAVGQEPACVKTCP
TGAIHFGTKAAMKTLAAERISELQGRGFTDAGLYDPPGVGGTHVMYVLHHADRPELYHGL
PKDPHIDTPITLWKDVLKPVAFAGFIATFIGLLYHYIAVGPNTEDEDDHDDTPRGNVDGQ
EHSQKQGHAEENHHEQK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaatcccaagacattattaagcgttcggccaccaattccctgacgccgccc
cccaacgggcgcaatcaccaggaggaagtggccaagctgatcgacgtgaccacctgcgtc
ggctgtaaagcctgccaggtaggctgttcagagtggaacgatatccgggatgaggtcgga
cactgcgtcggggtgtatgacaaccccgccgatctgagcgccaagtcctggacggtgatg
cgcttctcggaggtcgaggaaaacggcaagctggagtggctgatccgtaaggatggctgc
atgcactgcgccgatccgggctgcctgaaggcctgtccgtcggcgggcgccatcatccag
tacgccaacggtatcgtcgacttccagtccgagcactgcataggctgcggctactgcatc
gccggctgcccgttcaacgtgccgcgcatgaatccggaagacaaacgggtgtacaagtgc
actctgtgcgtcgaccgcgtcgccgtcggtcaggagccggcctgcgtcaaaacctgtccg
accggcgccatccactttggcaccaaggcggcgatgaagacgctggcggccgagcgcatc
agcgagctgcaggggcgcggcttcaccgatgccggtctgtacgatccgccgggcgtcggc
ggcacccacgtgatgtatgtgctgcaccatgccgaccgacccgagctgtaccacgggctg
ccgaaggatccgcatatcgatacccccatcacgctgtggaaggatgtgctcaagccggtc
gccttcgccggttttatcgctacctttatcgggctgctgtaccactacatcgccgtcggc
cctaacacggaggacgaagacgatcacgacgatacgccgcgggggaacgttgacgggcag
gagcatagccagaagcaaggacatgcagaggagaatcaccatgagcaaaaataa

DBGET integrated database retrieval system