KEGG   Edwardsiella sp. EA181011: QY76_04170Help
Entry
QY76_04170        CDS       T03991                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
edw  Edwardsiella sp. EA181011
Pathway
edw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
edw01100  Metabolic pathways
edw01110  Biosynthesis of secondary metabolites
edw01130  Biosynthesis of antibiotics
edw01230  Biosynthesis of amino acids
Module
edw_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:edw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    QY76_04170 (aroK)
Enzymes [BR:edw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     QY76_04170 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 dNK Cytidylate_kin Cytidylate_kin2 AAA_16 AAA AAA_22 TsaE APS_kinase ABC_tran AAA_24 AAA_5 AAA_25 AAA_7 AAA_17 His_biosynth Ploopntkinase3 AAA_28 RNA_helicase AAA_PrkA MMR_HSR1 AAA_2 RsgA_GTPase AAA_29 AAA_14 Mg_chelatase IstB_IS21 DUF1727 PduV-EutP
Motif
Other DBs
NCBI-ProteinID: AKM46642
LinkDB All DBs
Position
931382..931900
Genome map
AA seq 172 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVSWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDTPREVLEQLAQERNPLYEEIADVTIRTDEQSAKVVANQIIHLLENN
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagtactatt
ggccgtcagttagcgcagcagctgaacatggaattcttcgactccgaccaggagatcgaa
cgtcgtaccggcgccgatgtgagctgggtctttgacgttgagggcgaagagggctttcgc
gatcgcgaagagaaagtcatcaatgaactgacggagaagcaaggcatcgtgctggcgacc
gggggcggctccgtcaaatctcgcgagacccgtaatcgcctgtccgcgaggggcgtggtc
gtctatctggaaactaccattgaaaaacagctggcgcgtacgcagcgtgacaaaaaacgc
ccgttgctacaggtagatacgccgcgcgaggtgctggagcagctggcgcaggaacgcaat
ccgctgtatgaagagattgccgacgtgactatccgcacggatgagcagagcgccaaagtg
gtggccaaccagattatccatttgctggaaaacaactga

DBGET integrated database retrieval system