KEGG   Edwardsiella sp. EA181011: QY76_05970Help
Entry
QY76_05970        CDS       T03991                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
edw  Edwardsiella sp. EA181011
Pathway
edw00250  Alanine, aspartate and glutamate metabolism
edw00410  beta-Alanine metabolism
edw00430  Taurine and hypotaurine metabolism
edw00650  Butanoate metabolism
edw01100  Metabolic pathways
edw01110  Biosynthesis of secondary metabolites
edw01120  Microbial metabolism in diverse environments
edw02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:edw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    QY76_05970
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    QY76_05970
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    QY76_05970
   00430 Taurine and hypotaurine metabolism
    QY76_05970
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    QY76_05970
Enzymes [BR:edw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     QY76_05970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC PRTase_3
Motif
Other DBs
NCBI-ProteinID: AKM46950
LinkDB All DBs
Position
1344998..1346392
Genome map
AA seq 464 aa AA seqDB search
MKKGTDTRGGYLDSRFGSETIRTAAEAHHFPQGEMREDIAFQIINDELFLDGNARQNLAT
FCQTWDDDYVHRLMDISINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPRPADGQAIGTN
TIGSSEACMLGGMAMKWRWRAKRLAQGKPADKPNMVCGPVQVCWHKFARYWDVELREIPM
APGKLFMDPERMIAACDENTIGVVPTFGVTYTGNYEMPDVLHKALDDLQARTGLDIDMHV
DAASGGFLAPFCAPDIVWDFRLPRVKSISSSGHKFGLAPLGCGWVVWRDAASLPEDLIFK
VDYLGGQVGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVHTASYQVAQFLAAEIAKLGP
YEFICSGDPQQGIPAVCFRIPAGKELGYSLYDLSERLRLRGWQVPAFALNGEMSDVVVMR
IMCRRGFEMDFAQLLMADFRAALAYLKAHPAVAHVAHQNSFKHS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtactgacacccgtgggggatatttggattcccgctttggttcagagact
attcgcacggcggcggaggctcaccattttcctcagggagaaatgcgcgaagacattgct
ttccagattattaacgatgagctgtttttagatggcaatgcccggcaaaacctggcgacg
ttttgccagacctgggatgacgactatgtacaccgcctgatggatatttcgatcaataaa
aactggatcgataaagaggagtatccacagtcggcagcgatcgatctgcgctgcgtcaac
atggtggccgatctgtggcatgcgccgcgtccggcggacgggcaggccatcggtaccaat
accatcggctcctccgaggcctgcatgctgggcggcatggcgatgaagtggcgctggcgc
gccaagcgtctggcgcagggaaaaccagcggataaacccaatatggtgtgcgggccggta
caggtctgctggcataagtttgcccgctactgggatgtcgaactgcgcgagatcccgatg
gcgcccggcaagctgtttatggatccggagcggatgatcgccgcctgcgatgagaacacc
atcggcgtcgtgccgaccttcggcgtaacctacaccggtaactatgagatgcctgatgtg
ctgcacaaggcgttggacgatctgcaggcgcgtaccgggctggatatcgacatgcacgtc
gacgctgccagcggcggcttcctggcgccgttctgcgccccggatatcgtctgggacttc
cgcctgccgcgggtcaaatccatcagctcatccgggcataagttcggcttggcgccgctc
ggctgcggctgggtggtgtggcgcgacgccgcctccctgccggaggatctgatctttaag
gtggactatctgggtggacaggtcggtacctttgccattaacttttcccgtcccgcgggc
caggtgatcgcgcagtactatgagttcctgcgtctgggacgcgagggctacaccaaggtg
cataccgccagctatcaggtggcgcagttcctggcggcggagatcgctaagctggggccc
tatgagtttatctgtagcggtgatccgcagcagggcatcccggcggtgtgcttccgcatt
ccggccggcaaggagttgggctatagcctgtacgatctctccgagcgcctgcgcctgcgc
ggctggcaggttccggcctttgccctgaacggcgaaatgtccgatgtggtggtgatgcgc
atcatgtgccgccgcggctttgagatggacttcgctcagctgctgatggcggacttccgc
gcggcgctggcctatctcaaggcccatccggcagtggcccatgtggcgcatcagaacagc
ttcaagcattcctga

DBGET integrated database retrieval system