KEGG   Edwardsiella sp. EA181011: QY76_11640Help
Entry
QY76_11640        CDS       T03991                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
edw  Edwardsiella sp. EA181011
Pathway
edw00480  Glutathione metabolism
edw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    QY76_11640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:edw02000]
    QY76_11640
Enzymes [BR:edw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     QY76_11640
Transporters [BR:edw02000]
 Other transporters
  Pores ion channels [TC:1]
   QY76_11640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AKM47907
LinkDB All DBs
Position
2649199..2649804
Genome map
AA seq 201 aa AA seqDB search
MKLFYKSGACSLSPHIVLREAGLDFTIESVDLASKRTEHGSDYLRINPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRALIPPQETLARYHAIEWLNYIATEIHKGFSPLFNPRQPQE
SKAIARAALEKQFHYLNGVLSERPYLLGPSFSVADAYLFTTLCWAKAMHFDLAVWPALAD
YMARIAARPAVDATLSAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttctataaatccggggcctgctctctttcaccgcatatcgtactgcgtgag
gccggtctggacttcaccatcgaaagtgtggatctggccagcaaacgtaccgagcacggc
agcgactatctgcgcattaatcccaagggacaggtgccggcgctgctgctggatgacggc
agtctgctgaccgaaggggtggccatcgtgcagtacctggccgatcgggtgccagaccgc
gcgctgatcccgccgcaggagacgctggcgcgctatcacgcgatcgaatggctcaactat
attgccaccgagatccataagggattcagcccgctgttcaatccgcgccagccgcaggag
agcaaggcgatagcgcgcgcggcgctggagaagcagttccactacctcaacggcgtactc
agcgagcgtccctacctgctggggcccagcttcagcgtcgccgacgcctatctgttcacc
acgctgtgctgggccaaggcgatgcacttcgatctggccgtctggccggcgctggccgac
tatatggcgcgtatcgccgcgcggccggcggtcgatgctacgctcagcgccgaggggttg
aagtag

DBGET integrated database retrieval system