KEGG   Enterobacter ludwigii EcWSU1: EcWSU1_00122Help
Entry
EcWSU1_00122      CDS       T01652                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
eec  Enterobacter ludwigii EcWSU1
Pathway
eec00260  Glycine, serine and threonine metabolism
eec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcWSU1_00122 (tdh)
Enzymes [BR:eec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     EcWSU1_00122 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 FAD_binding_2 HI0933_like Pyr_redox_3 FAD_oxidored Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: AEW71562
UniProt: G8LFS7
LinkDB All DBs
Position
118225..119253
Genome map
AA seq 342 aa AA seqDB search
MMKALSKLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHIYNWDQWSQKTIPVPM
VVGHEYVGEVVGMGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPG
CFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMA
AAVAKHVGARNVVITDVNEYRLSLARKMGVTRAVDVSKESLSDVMEELGMTEGFDVGLEM
SGAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWNKVIFKGLFIKGIYGREMFETWYKMA
ALIQSGLDLSPIITHRFSIDEFQEGFDAMRSGQSGKVILSWD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaagcgttatccaaactgaaagcggaagaagggatttggatgaccgacgtgccg
gagccggaagtcggtcataacgatctgctgatcaaaattcgtaaaaccgccatttgcggc
actgacgttcatatctacaactgggaccagtggtcgcagaaaaccattccggtaccgatg
gtcgtgggccacgaatatgtcggcgaagtggtgggcatgggtcaggaagtaaaaggcttc
aacattggcgaccgcgtctcgggtgaaggtcatattacctgtggtcactgccgtaactgc
cgcggtggacgcacgcacctgtgccgcaacacaatcggcgtgggcgtgaaccgtccgggc
tgcttcgcagaatacctggtgatcccggcgtttaacgcgttcaaaatcccggacaacatt
tctgacgatctggcctctatctttgatcccttcggcaacgcggtacacacggcactctct
ttcgacctggtcggtgaagatgtactggtttccggcgcgggtcccatcgggattatggcg
gccgcggtggcgaagcacgttggtgcccgcaatgtggtgattaccgatgtgaacgagtat
cgcctgtcgctggcgcgcaaaatgggtgtgacccgcgcggtggatgtctctaaagagagc
ctgagcgacgtgatggaagagctgggcatgaccgaaggttttgacgtgggtcttgagatg
tccggcgcaccaccggcgtttcgcaccatgctggacaccatgaatcacggcggacgtatt
gcgatgctgggcattccaccgtctgatatgtctatcgactggaacaaggttatcttcaag
gggctgttcatcaaaggtatctacggccgcgagatgttcgaaacctggtacaagatggcg
gcactgatccagtctggtctggacctgtctccgattatcacccatcgcttctccatcgat
gagttccaggaaggctttgacgcgatgcgctctggccagtccgggaaggttatcctgagc
tgggattag

DBGET integrated database retrieval system