KEGG   Enterobacter ludwigii EcWSU1: EcWSU1_01195Help
Entry
EcWSU1_01195      CDS       T01652                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
eec  Enterobacter ludwigii EcWSU1
Brite
KEGG Orthology (KO) [BR:eec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EcWSU1_01195 (ahpF)
Enzymes [BR:eec01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EcWSU1_01195 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 FAD_binding_3 Thi4 K_oxygenase Glutaredoxin AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AEW72634
UniProt: G8LE58
LinkDB All DBs
Position
1254630..1256228
Genome map
AA seq 532 aa AA seqDB search
MHDDVFREGRTMLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPN
VTFKEDNGLAVRKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALL
EQIRDIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVM
GVPAVFMNGQEFGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAV
YSARKGIRTGLMGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYEVDVIDSQS
ASKLVPAAVEGGLHQIETASGAVLKARSIIIATGAKWRNMNVPGEGQYRTKGVTYCPHCD
GPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIV
LNAQTTEVKGDGSKVTGLEYRDRVSGDVHSVALAGIFVQIGLLPNTTWLDGAIERNRMGE
IIIDAKCETSVKGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
ttgcatgatgacgtttttagagagggaagaacaatgctcgacaccaatatgaaaacccag
ctcaaggcctaccttgagaaactgaccaaacctgttgagctgattgccacgctggacgac
agcgctaaatcggcagagatcaaggaactgctggcagagatcgccgaactgtcaccgaac
gtgaccttcaaagaagataacggtctggcggtgcgcaagccctccttcttgatcaccaat
ccgggttctgaccaggggccgcgttttgccggttctccactgggccacgaatttacctcg
ctggtgctggcactgctgtggactggtggtcatccgtcaaaagaggcgcaggcgctgctc
gagcagatccgcgatattgacggcgattttgagtttgaaacctattactcactctcctgc
cataactgcccggacgtggtgcaggcgctgaacctgatgtcggtgctgaacccgcgcatt
aagcacacggcgattgacggcggtacgttccagaacgaaatcaccgaccgtaacgtcatg
ggcgttccggcggtctttatgaacggtcaggagtttggccagggccgtatgacgctgacc
gaaatcgttgccaaagtggacacgggtgccgaaaaacgtgcggcagaagcgctgaacaaa
cgtgatgcgtatgatgttctgattgtcggctccggcccggcgggcgcggcggcggcggtt
tactccgcccgtaaaggcattcgtaccggactgatgggcgaacgcttcggtggccaggtg
ctcgacaccgtggatatcgaaaactacatctctgtgccgaagaccgaaggccagaaactg
gctggcgcactgaaggcgcacgttagcgattatgaagtggatgtgatcgacagccagagc
gccagcaagctggttccggccgcggttgaaggggggttacaccagattgaaaccgcctcc
ggcgcggtgctgaaagcgcgcagcattatcattgccaccggcgccaaatggcgcaacatg
aacgtcccgggtgaaggtcagtatcgcaccaaaggcgtcacctactgcccgcactgcgac
ggcccgctgtttaaaggtaaacgcgtggcggtgatcggcggcggtaactccggtgtggaa
gcggcgattgacctggcgggtatcgttgaacacgtcaccctgctggagttcgccccagaa
atgaaagcggaccaggtgctgcaggacaaagtgcgtagcctgaaaaacgtcgatatcgtg
ctgaatgcgcagaccacggaagtgaaaggtgacggcagcaaagtaaccggtctggaatac
cgcgaccgcgtgagcggtgacgtacatagcgtggcgctggcggggatcttcgtacagatt
ggtctgttgccaaacaccacctggctggacggcgcgattgagcgcaaccggatgggcgaa
attattatcgatgcgaaatgcgaaaccagcgtgaaaggggtgttcgcggcaggggactgc
accacggttccgtacaaacagatcatcattgccaccggtgaaggggcgaaagcgtctctg
agctcgttcgattatctgattcgcaccaaaacggcataa

DBGET integrated database retrieval system