KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02875Help
Entry
EcWSU1_02875      CDS       T01652                                 

Gene name
amyA
Definition
(GenBank) Cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00500  Starch and sucrose metabolism
eec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EcWSU1_02875 (amyA)
Enzymes [BR:eec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     EcWSU1_02875 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: AEW74306
UniProt: G8LHY2
LinkDB All DBs
Position
2973784..2975319
Genome map
AA seq 511 aa AA seqDB search
MIHTPEVCQTASGARTMKNPTLLQCFHWYYPAGGELWREVTALAPNLNEIGINMIWLPPA
CKGASGGYSVGYDTYDLFDLGEFDQKGSVATKYGDKAQLLEAIDALKSNEIAVLLDVVVN
HKMGADEKEPVRVQRVNEQDRTQIDDEIIECEAWTRYTFPARAGQYSQFIWDYKCFSGVD
HIENPDEDGIFKIVNDYTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVM
EQTGCDGFRLDAVKHIPAWFYKEWIEHVQEVATQPLFIVAEYWSHEVDKLQAYIDQVDGK
TMLFDAPLQMKFHEASRQGREYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVE
AWFKPLAYALILLRENGVPSVFYPDLFGASYDDTGGDGETYHIDMPVIEQLHELILARQR
FAHGVQTLFFDHPNCIAFSRSGTEDDPGCVVVMSNGDDGEKVICLGENYGNKTWRDFLGN
REETVITAADGEGTFTCKGGSVSVWVIEDAL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
ttgatccatactccagaagtctgccaaacggcttctggagcacggacgatgaaaaacccc
accctgttacaatgttttcactggtattaccctgcgggcggtgaattgtggcgagaggtc
acggcgttagcccccaatcttaacgaaatcggcatcaatatgatctggttgccgccagcc
tgtaaaggcgcatccggcgggtactcggtcggatacgatacttacgatctcttcgacctc
ggtgagtttgaccagaaaggcagcgtcgccaccaagtacggtgataaagctcagctgctg
gaggccatcgacgcactcaaaagtaatgagatcgccgtcctccttgacgtggtggttaac
cacaaaatgggcgcagacgagaaagaacccgtccgcgttcagcgcgtcaacgaacaggat
cgcacgcagatcgacgatgagatcattgagtgtgaagcctggacacgctacaccttccct
gcccgtgccgggcaatattcgcagtttatctgggattacaaatgcttcagcggcgtcgac
catattgaaaaccccgatgaagacggcatttttaaaatcgtcaacgactacaccggtgaa
ggctggaacgaccaggttgatgatgagatgggtaattttgattacctgatgggcgaaaac
attgattttcgcaaccatgccgtcaccgaggagatcaaatactgggcccgctgggtcatg
gaacaaactggctgtgacggttttcgtctggacgccgtcaaacacattcccgcctggttt
tataaggagtggattgagcacgttcaggaagtcgcaacgcaaccgttgtttatcgtggcg
gaatactggtcccacgaagtggataaactgcaggcctatattgaccaggtcgatggcaag
acgatgctgttcgatgcccccctgcagatgaaattccacgaagcatcgcgccagggtcgg
gaatacgacatgagccaaatctttaccggcaccctggtcgaagccgatccgttccatgca
gtaactctggttgccaaccatgacactcagcctttgcaggcactggaagcgccggttgaa
gcgtggtttaaaccgctggcctatgccctgatcctgctgcgtgaaaacggagtgcccagc
gtcttttatccggatttattcggtgccagctatgacgatacgggcggtgacggcgaaacc
taccatattgatatgccggtcatcgagcagcttcacgagctgatcctcgcccgccagcgt
tttgcccacggcgtgcagacgctgttcttcgatcacccaaactgtatcgccttcagccgc
agcggcaccgaagacgatcctggctgtgtggtggtgatgtcgaatggcgatgacggcgag
aaagtgatttgtctgggtgaaaactacggcaacaaaacgtggcgtgattttctcggcaat
cgcgaagaaacggtcattaccgcggcagatggcgaaggcacctttacctgcaaaggtgga
agcgtcagcgtgtgggtgattgaggatgcgttgtag

DBGET integrated database retrieval system